Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U226616

Score 
187
Direction 
Forward
Predicted Peptide Sequence 
EXFATAGSDGSFNFWDKDSKQRLKAMSRCSQPIPCSAFNNDGSIYAYAVCYDWSKGAENHNPSTAKTNIYLHFPQDSEVKGKPRIGTSGR
K
Predicted Coding Sequence 
GAAXCATTTGCAACTGCGGGATCTGATGGTTCCTTCAATTTTTGGGATAAAGATAGCAAACAGAGGCTCAAGGCAATGTCAAGATGCAGC
CAGCCCATACCTTGCAGCGCGTTCAACAATGATGGCTCAATCTACGCATATGCGGTTTGTTATGATTGGAGCAAGGGTGCAGAAAATCAT
AATCCATCAACTGCAAAAACAAACATTTACTTGCATTTCCCACAGGATTCTGAGGTTAAAGGCAAGCCACGAATTGGAACTAGCGGTAGA
AAGTGA\
Edits in Original Sequence 
(5')GAAXCATTTGCAACTGCGGGATCTGATGGTTCCTTCAATTTTTGGGATAAAGATAGCAAACAGAGGCTCAAGGCAATGTCAAGATG
CAGCCAGCCCATACCTTGCAGCGCGTTCAACAATGATGGCTCAATCTACGCATATGCGGTTTGTTATGATTGGAGCAAGGGTGCAGAAAA
TCATAATCCATCAACTGCAAAAACAAACATTTACTTGCATTTCCCACAGGATTCTGAGGTTAAAGGCAAGCCACGAATTGGAACTAGCGG
TAGAAAGTGA\(3')AGTCAGCAGGAAAAGCCTCATCTTACCATTTCAGAGAAAGTTTGTTTTGTTCCGTCTGCAGTCGTGCTATTAATT
CATGGGAGTAGATAGGAGTTTGAGCTTTGAACAGTCAGTAGATAGTGATTTTGAGTGTGATATTCCTTATTAGTAGGAGCTTGCTTGTGC
CAATACTTGTAATCTCCTTAGAGAATTAGATAATTGCTTAGTCTCCATGTAGCCTCTGAAACTTTATGGCACTTTCTGTTTGAATAGCCG
TTTTATTTCTATTTCTAGAGTTCATGAAGTAAAAAAAAAAAAAAAAAAAAACTGGAGACTAGTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan