ESTScan Details for Unigene SGN-U226693

Score 
107
Direction 
Forward
Predicted Peptide Sequence 
GDDDLKPAVTAEPEITSTTLSAEDEYIVTDYNNKISFRDISVY
Predicted Coding Sequence 
XXTGGCGATGATGATCTGAAGCCAGCTGTAACTGCAGAACCTGAGATAACTTCGACTACTCTTTCTGCCGAGGATGAATACATTGTXACG
GATTACAACAACAAAATTTCATTCCGTGATATTTCAGTGTACTAA\
Edits in Original Sequence 
(5')XXTGGCGATGATGATCTGAAGCCAGCTGTAACTGCAGAACCTGAGATAACTTCGACTACTCTTTCTGCCGAGGATGAATACATTGT
XACGGATTACAACAACAAAATTTCATTCCGTGATATTTCAGTGTACTAA\(3')TTGTTATCAAATCCTAGTAGTGAATATATGTTTATA
TGTGACCACATTTTACCCACTTCCAGACCAATAAGTTGATTCTCAGATCGGATTTACCTTCTTATCTCTGATTCTATTAAAACAAGTTAT
TTGCAAGCAAAAAAAAAAAAAAAAAAAAAAAAAACCCCCGGGGGGGGGCCCGGGCCCCATTTCCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan