ESTScan Details for Unigene SGN-U226905

Score 
382
Direction 
Forward
Predicted Peptide Sequence 
NYQGKNILGLLNFLLCAVLTHFVETXILALLYSSFLFVAEIXSAEFFFLERIGELSILGKLEKAGXLAANLPTAYTRRCFHLQFAFQQQF
FKFSQITQVASEPTNVKAILMTENFPVSLSKXPSSSARFDVSASFCRDNELVCQLEVPGDKICSVNSFVADSSLLGRLLQSSSSLKEVKI
LHAIXIKVFEEQYYIVENNLISVLXEIWGXLDDARKVFDHMPERNVVSWTAMLNGYL
Predicted Coding Sequence 
AATTACCAAGGCAAAAATATCTTGGGCCTTCTAAACTTTCTCCTCTGTGCTGTGCTGACGCATTTTGTTGAAACTTGAATTCTTGCTTTG
CTCTATTCTTCCTTCTTGTTTGTTGCTGAAATTXTATCAGCTGAGTTCTTCTTTCTTGAGAGAATTGGGGAATTATCAATTCTTGGAAAA
TTAGAGAAAGCTGGAGXTCTTGCTGCTAATTTACCTACAGCATATACTAGGCGATGTTTTCACCTTCAATTTGCTTTCCAACAACAATTC
TTCAAATTCAGCCAGATAACACAAGTCGCTTCAGAACCCACAAATGTAAAAGCTATACTGATGACAGAAAACTTCCCTGTTTCTCTTTCA
AAGAXCCCATCTTCCTCAGCTCGTTTTGATGTTTCTGCAAGTTTTTGTAGAGACAATGAATTAGTTTGTCAATTGGAAGTTCCAGGTGAT
AAAATTTGTTCAGTGAATAGTTTTGTGGCTGATTCAAGTTTGCTTGGTCGTTTGCTTCAATCTAGTTCTAGTTTAAAAGAAGTTAAAATA
CTTCATGCGATTGXTATTAAAGTGTTTGAGGAGCAGTACTATATTGTTGAGAATAATTTGATTAGTGTGTTGGNTGAAATTTGGGGCGXT
TTGGATGACGCTCGTAAGGTGTTCGATCATATGCCTGAGAGGAATGTGGTTTCTTGGACTGCTATGCTTAATGGGTATTTG\
Edits in Original Sequence 
(5')AATTACCAAGGCAAAAATATCTTGGGCCTTCTAAACTTTCTCCTCTGTGCTGTGCTGACGCATTTTGTTGAAACTTGAATTCTTGC
TTTGCTCTATTCTTCCTTCTTGTTTGTTGCTGAAATTXTATCAGCTGAGTTCTTCTTTCTTGAGAGAATTGGGGAATTATCAATTCTTGG
AAAATTAGAGAAAGCTGGAGXTCTTGCTGCTAATTTACCTACAGCATATACTAGGCGATGTTTTCACCTTCAATTTGCTTTCCAACAACA
ATTCTTCAAATTCAGCCAGATAACACAAGTCGCTTCAGAACCCACAAATGTAAAAGCTATACTGATGACAGAAAACTTCCCTGTTTCTCT
TTCAAAGAXCCCATCTTCCTCAGCTCGTTTTGATGTTTCTGCAAGTTTTTGTAGAGACAATGAATTAGTTTGTCAATTGGAAGTTCCAGG
TGATAAAATTTGTTCAGTGAATAGTTTTGTGGCTGATTCAAGTTTGCTTGGTCGTTTGCTTCAATCTAGTTCTAGTTTAAAAGAAGTTAA
AATACTTCATGCGATTGXTATTAAAGTGTTTGAGGAGCAGTACTATAtTTGTTGAGAATAATTTGATTAGTGTGTTGGNTGAAATTTGGG
GCGXTTTGGATGACGCTCGTAAGGTGTTCGATCATATGCCTGAGAGGAATGTGGTTTCTTGGACTGCTATGCTTAATGGGTATTTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan