ESTScan Details for Unigene SGN-U226970

Score 
585
Direction 
Forward
Predicted Peptide Sequence 
VALLLGISMLGFLXADINFVCVNCINGDHELXDAGFDHNSAATLVGLFAAGCALGSFFGGVVADKISRIYPHTGRVMCAQFSSFMGIPFS
WFLLRIISPSISSYSTFAVTLFIMGLTISWCATATNGPMFAEVVPSKHRTMIYAFDRAFEGSFSSFAAPIVGILAEKMYGYDAKSVDPIL
GSPREALAAVKRPLFNDGRAFWFMLLVFTPLYWTFKQDRENARLAAAKETEMIDDSTAFQFFVYSFFLDLWAHLTSSAHLDMEFLSMTTY
RNAAAACRPKQHSSLLILQIFHLVVSTRAADYVSITLVSSNRSYSKFKHXIDADVAGIRHSNIEVVASALAH
Predicted Coding Sequence 
GTGGCCCTTCTTTTAGGAATTAGCATGTTGGGTTTTCTTGXTGCTGATATAAATTTTGTTTGTGTTAACTGCATCAACGGTGATCATGAA
CTTXCTGATGCAGGTTTTGATCATAATAGTGCAGCCACACTTGTCGGTCTATTTGCTGCTGGATGCGCATTAGGATCCTTCTTTGGTGGA
GTAGTTGCAGACAAAATTTCTCGAATATACCCCCATACAGGACGTGTCATGTGTGCTCAATTTAGTTCTTTTATGGGCATCCCATTCTCA
TGGTTCCTTCTTCGAATTATCTCTCCGTCTATAAGCAGCTATTCCACATTTGCTGTGACTTTATTCATAATGGGCCTCACAATCAGCTGG
TGTGCTACTGCTACAAATGGTCCCATGTTTGCAGAAGTGGTGCCTTCAAAGCACCGCACCATGATTTATGCTTTTGATCGTGCGTTTGAG
GGTTCATTTTCTTCTTTTGCTGCTCCAATTGTAGGGATTCTTGCTGAGAAAATGTACGGTTATGATGCCAAATCTGTTGATCCGATATTA
GGATCTCCAAGGGAGGCTTTAGCXGCTGTCAAAAGGCCTCTTTTCAATGATGGCCGTGCCTTTTGGTTTATGTTGCTTGTTTTCACCCCT
TTGTATTGGACATTCAAGCAGGATCGTGAGAATGCAAGACTTGCTGCTGCAAAAGAAACAGAGATGATTGACGATTCCACXGCTTTTCAG
TTCTTTGTTTATTCATTCTTCTTGGATCTTTGGGCTCATCTGACAAGTTCAGCTCATTTGGATATGGAGTTTCTTTCTATGACCACTTAT
AGAAATGCTGCTGCAGCCTGTAGGCCAAAACAACACTCTTCCCTTCTAATTTTGCAGATATTTCATTTGGTGGTTAGCACTAGGGCGGCA
GATTATGTCTCCATTACACTTGTCTCATCTAACAGATCATACTCAAAATTCAAACATGXTATAGATGCTGATGTTGCTGGCATCAGGCAC
TCCAACATTGAAGTAGTTGCTTCGGCATTGGCACACTGA\
Edits in Original Sequence 
GTTTTCTTTACATTATGGTTTGAATTAATCGGTAA(5')GTGGCCCTTCTTTTAGGAATTAGCATGTTGGGTTTTCTTGXTGCTGATATA
AATTTTGTTTGTGTTAACTGCATCAACGGTGATCATGAACTTXCTGATGCAGGTTTTGATCATAATAGTGCAGCCACACTTGTCGGTCTA
TTTGCTGCTGGATGCGCATTAGGATCCTTCTTTGGTGGAGTAGTTGCAGACAAAATTTCTCGAATATACCCCCATACAGGACGTGTCATG
TGTGCTCAATTTAGTTCTTTTATGGGCATCCCATTCTCATGGTTCCTTCTTCGAATTATCTCTCCGTCTATAAGCAGCTATTCCACATTT
GCTGTGACTTTATTCATAATGGGCCTCACAATCAGCTGGTGTGCTACTGCTACAAATGGTCCCATGTTTGCAGAAGTGGTGCCTTCAAAG
CACCGCACCATGATTTATGCTTTTGATCGTGCGTTTGAGGGTTCATTTTCTTCTTTTGCTGCTCCAATTGTAGGGATTCTTGCTGAGAAA
ATGTACGGTTATGATGCCAAATCTGTTGATCCGATATTAGGATCTCCAAGGGAGGCTTTAGCXGCTGTCAAAAGGCCTCTTTTCAATGAT
GGCCGTGCCTTTTGGTTTATGTTGCTTGTTTTaCACCCCTTTGTATTGGACATTCAAGCAGGATCGTGAGAATGCAAGACTTGCTGCTGC
AAAAGAAACAGAGATGATaTGACGATTCCACXGCTTTTCAGTTCTTTGTTTATTCATTCTTCTTGGATCTTTGGGCTCATCTGACAAGTT
CAGCTCATTTGGATATGGAGTTTCTTTCTATGACCACTTATAtGAAATGCTGCTGCAGCCTGTAGGCCAAAACAACACTCTTCCCTTCTA
ATTTTGCAGATATTTCATTTGGTGGTTAGCACTAGGGCGGCAGATTATGTCTCCATTACACTTGTCTCATCTAACAGATCATACTCAAAA
TTCAAACATGXTATAGATGCTGATGTTGcCTGGCATCAGGCACTCCAACATTGAAGTAGTTGCTTCGGCATTGGCACACTGA\(3')CAG
GGTTATCTGTTTGTCTATGTTTTTACATGTAAATCCTGCCATTTTTGAAGTAAGAAAGCTGCAGAACTTTAACATAAAGAAAAAAAAAAA
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan