ESTScan Details for Unigene SGN-U227098

Score 
396
Direction 
Forward
Predicted Peptide Sequence 
IATTPSEIKNSTHEIFNVKESIAQLDTKPQTPFENQEEYHVDNEIEQESGNLKLKLNLIHRDKLQIPHFPYNNDKVFEGRISRDLKRVSS
IIHRIENGGVNYRVKEFGSDLISGMDQGSGEYFVRVGVGSPPKNQYMVLDSGSDIGWDSVSPVPNVITNPDPVFDPSLSVSFTGVS
Predicted Coding Sequence 
ATAGCAACAACTCCAAGTGAAATCAAAAACTCAACTCATGAAATCTTCAATGTAAAAGAATCCATTGCTCAATTAGATACAAAACCCCAA
ACCCCATTTGAAAATCAAGAAGAATATCATGTTGATAATGAAATTGAACAAGAAAGTGGAAATTTGAAGCTCAAGCTCAACCTCATTCAT
AGAGACAAACTTCAAATTCCCCATTTTCCATATAACAATGACAAAGTATTTGAAGGCAGAATCAGTAGAGATTTGAAAAGGGTGTCTAGT
ATCATTCACAGAATTGAAAATGGTGGTGTTAATTACCGGGTCAAGGAATTCGGGTCGGATCTTATTTCGGGTATGGATCAAGGTAGTGGG
GAATATTTTGTTAGGGTTGGTGTAGGTAGTCCACCTAAGAACCAATACATGGTTCTTGATTCTGGTAGTGATATTGGTTGGGACAGTGTC
AGCCCTGTACCCAATGTTATCACCAATCCXGACCCGGTATTCGACCCATCTCTTTCCGTGTCGTTTACTGGCGTCTCX\
Edits in Original Sequence 
CTCACCACACACACACACAAAAAAAAATGTTTCTCCCCTTTCTAGCCTTAGCAATTTTACTCATTTTCTCTCCTACCACC(5')ATAGCA
ACAACTCCAAGTGAAATCAAAAACTCAACTCATGAAATCTTCAATGTAAAAGAATCCATTGCTCAATTAGATACAAAACCCCAAACCCCA
TTTGAAAATCAAGAAGAATATCATGTTGATAATGAAATTGAACAAGAAAGTGGAAATTTGAAGCTCAAGCTCAACCTCATTCATAGAGAC
AAACTTCAAATTCCCCATTTTCCATATAACAATGACAAAGTATTTGAAGGCAGAATCAGTAGAGATTTGAAAAGGGTGTCTAGTATCATT
CACAGAATTGAAAATGGTGGTGTTAATTACCGGGTCAAGGAATTCGGGTCGGATCTTATTTCGGGTATGGATCAAGGTAGTGGGGAATAT
TTTGTTAGGGTTGGTGTAGGTAGTCCACCTAAGAACCAATACATGGTTCTTGATTCTGGTAGTGATATTGGTTGGGtACAGTGTCAGCCC
TGTACCCAATGTTATCACCAATCCXGACCCGGTATTCGACCCATCTCTTTCCGTGTCGTTTACTGGCGTCTCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan