ESTScan Details for Unigene SGN-U227116

Score 
795
Direction 
Forward
Predicted Peptide Sequence 
EMLREILGNCSDVLVYRDAQGSTLLHSASGRGQVEVVKSLLERYELINSRDNQGNTALHVAAYRGYLAVVKVLISVSPSSTTLRNNYGDT
FLHMAVAGLSDPKFPQAGSSNGVNETVGRGKIIEIEDIINIKNNDGRTALHLAVIENIQTDVVELLMTAFSINLNIRDADGNTPLDLLKL
RPQSASSEILIKRLISAGGISELPRPYDKNYPSFPPEEQGIGGSPGASFRIPDAEIFLYAGIDNAFDANSDCASTEIASCWGEPSPCHSA
AGSNSSNKLSSVNSAARRLKFLLRWKRKKERKEX
Predicted Coding Sequence 
GAGATGTTGAGAGAGATTCTTGGAAATTGCTCTGATGTTTTGGTTTATAGAGATGCTCAAGGATCTACTCTCTTGCATTCTGCTTCTGGT
AGAGGACAGGTTGAGGTTGTTAAGAGCTTACTGGAAAGGTATGAACTTATCAACTCCAGAGACAACCAAGGAAACACTGCACTGCATGTA
GCTGCTTATAGGGGTTACTTAGCAGTGGTGAAAGTTCTTATATCTGTCTCTCCTTCATCTACTACATTGAGAAACAATTACGGAGACACG
TTCCTTCACATGGCTGTAGCTGGXCTTTCGGACCCCAAGTTTCCACAGGCTGGATCGTCAAATGGAGTTAATGAAACAGTTGGTAGGGGA
AAAATTATAGAGATTGAAGACATTATCAACATCAAGAACAATGATGGTCGAACTGCTCTTCATTTGGCTGTAATTGAGAACATTCAGACT
GATGTTGTGGAACTCCTTATGACTGCATTTTCAATAAATCTAAATATCCGTGATGCTGATGGAAATACTCCACTGGATCTCCTCAAGCTA
CGCCCGCAATCTGCATCTTCTGAGATATTGATTAAGCGCCTCATTTCAGCTGGAGGAATTTCXGAATTGCCAAGACCATATGACAAGAAC
TATCCTAGCTTCCCACCTGAAGAACAGGGTATTGGAGGTAGTCCTGGTGCCTCTTTTAGGATCCCCGACGCTGAAATATTTCTGTATGCT
GGCATTGATAATGCTTTTGATGCCAATAGTGATTGTGCAAGCACAGAAATTGCTTCGTGCTGGGGTGAACCGAGCCCTTGCCATTCTGCT
GCAGGGTCGAACTCATCAAACAAGCTAAGCTCAGTTAACAGTGCTGCTAGACGCTTAAAGTTTCTTCTACGATGGAAAAGGAAGAAAGAA
CGAAAAGAAGAX\
Edits in Original Sequence 
(5')GAGATGTTGAGAGAGATTCTTGGAAATTGCTCTGATGTTTTGGTTTATAGAGATGCTCAAGGATCTACTCTCTTGCATTCTGCTTC
TGGTAGAGGACAGGTTGAGGTTGTTAAGAGCTTACTGGAAAGGTATGAACTTATCAACTCCAGAGACAACCAAGGAAACACTGCACTGCA
TGTAGCTGCTTATAGGGGTTACTTAGCAGTGGTGAAAGTTCTTATATCTGTCTCTCCTTCATCTACTACATTGAGAAACAATTACGGAGA
CACGTTCCTTCACATGGCTGTAGCTGGXCTTTCGGACCCCAAGTTTCCACAGGCTGGATCGTCAAATGGAGTTAATGAAACAGTTGGTAc
GGGGAAAAATTATAGAGATTGAAGACATTATCAACATCAAGAACAATGATGGTCGAACTGCTCTTCATTTGGCTGTAATTGAGAACATTC
AGACTGATGTTGTGGAACTCCTTATGACTGCATTTTCAATAAATCTAAATATCCGTGATGCTGATGGAAATACTCCACTGGATCTCCTCA
AGCTACGCCCGCAATCTGCATCTTCTGAGATATTGATTAAGCGCCTCATTTCAGCTGGAGGAATTTCXGAATTGCCAAGACCATATGACA
AGAACTATCCTAGCTTCCCACCTGAAGAtACAGGGTATTGGAGGTAGTCCTGGTGCCTCTTTTAGGATCCCCGACGCTGAAATATTTCTG
TATGCTGGCATTGATAATGCTTTTGATGCCAATAGTGATTGTGCAAGCACAGAAATTGCTTCGTGCTGGGGTGAACCGAGCCCTTGCCAT
TCTGCTGCAGGGTCGAACTCATCAAACAAGCTAAGCTCAGTTAACAGTGCTGCTAGACGCTTAAAGTTTCTTCTACGATGGAAAAGGAAG
AAAGAACGAAAAGAAGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan