ESTScan Details for Unigene SGN-U227155

Score 
434
Direction 
Forward
Predicted Peptide Sequence 
MSVAAMGIVSGGIGYLSQLFTSDIAASTHQFCCFSVNSSPLHMNFSRSGCLVKRGSLLSPRVSVSTTGNAKIDGVDDQLSLSPDEIKPAR
KSADWKAARTYSERGLIFEGKVEGFNGGGXADSILFSRGFSALPTDEPLSLLKQPQKTIQEIAEGLDGSVLSVX
Predicted Coding Sequence 
ATGTCTGTTGCAGCAATGGGCATAGTTTCAGGAGGCATTGGGTATCTTTCACAGTTGTTTACAAGTGATATAGCTGCTTCTACTCATCAG
TTTTGTTGTTTTTCAGTGAATTCAAGCCCATTGCATATGAATTTTTCTAGGAGTGGTTGTTTGGTGAAAAGGGGTTCTTTGTTAAGCCCT
AGAGTTTCAGTTTCTACTACTGGTAATGCTAAGATTGATGGAGTTGATGATCAGTTATCTTTGTCACCTGATGAGATCAAACCAGCTCGG
AAGTCTGCTGATTGGAAAGCAGCAAGGACATACAGTGAGAGGGGACTGATATTTGAGGGCAAGGTTGAAGGCTTCAATGGTGGTGGTXTT
GCTGATTCGATTTTATTCTCTCGTGGGTTTTCTGCCCTTCCCACAGATGAGCCCTTATCACTCTTGAAACAACCACAAAAGACTATTCAA
GAGATTGCXGAGGGACTTGACGGGTCTGTCCTCTCTGTGAAX\
Edits in Original Sequence 
CCAAATTTCCCAAAACCATGAAAAAAGCTTCCAATTCGCAAAACTAACTCCACCCCATCTCTCAAAATTCAATCTTTTTTCAATCTCTGT
CCAAATCTTGATTATTAGATTAGTACTGATA
(5')ATGTCTGTTGCAGCAATGGGCATAGTTTCAGGAGGCATTGGGTATCTTTCACAGT
TGTTTACAAGTGATATAGCTGCTTCTACTCATCAGTTTTGTTGTTTTTCAGTGAATTCAAGCCCATTGCATATGAATTTTTCTAGGAGTG
GTTGTTTGGTGAAAAGGGGTTCTTTGTTAAGCCCTAGAGTTTCAGTTTCTACTACTGGTAATGCTAAGATTGATGGAGTTGATGATCAGT
TATCTTTGTCACCTGATGAGATCAAACCAGCTCGGAAGTCTGCTGATTGGAAAGCAGCAAGGACATACAGTGAGAGGGGACTGATATTTG
AGGGCAAGGTTGAAGGCTTCAATGGTGGTGGTXTTGCTGATTCGATTTTATTCTCTCGTGGGTTTTCTGCCCTTCCCACAGATGAGCCCT
TATCACTCTTGtAAACAACCACAAAAGACTATTCAAGAGATTGCXGAGGGACTTGACGGGTCTGTCCTCTCTGTGAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan