Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U227585

Score 
371
Direction 
Reverse
Predicted Peptide Sequence 
KNDVWTLAILILEMLTGKFPSNFLQQGKGSDTDLATWVRSVVNEDMTEVDVFEKDMRGTTNSEGEMMKLLKIALGCCDLDMEKRFDMKEA
MERIEEVKERDGDDDFYSTRGLSDDYTQVSMNI
Predicted Coding Sequence 
XGTAAAAATGATGTGTGGACGCTTGCAATATTGATCCTCGAGATGTTAACAGGCAAATTCCCGTCTAATTTCTTGCAACAAGGCAAGGGG
AGTGACACGGATTTGGCTACGTGGGTAAGGTCCGTGGTAAATGAGGACATGACGGAGGTAGATGTATTCGAGAAGGATATGAGGGGTACA
ACGAATTCGGAGGGAGAAATGATGAAGTTATTGAAGATAGCTTTGGGTTGTTGTGATCTTGATATGGAAAAGAGGTTTGATATGAAGGAA
GCAATGGAAAGGATTGAGGAAGTAAAAGAGAGAGATGGGGATGATGATTTCTACTCTACAAGAGGATTATCCGATGATTATACTCAGGTT
TCGATGAACATTTAG\
Edits in Original Sequence 
(5')XGTAAAAATGATGTGTGGACGCTTGCAATATTGATCCTCGAGATGTTAACAGGCAAATTCCCGTCTAATTTCTTGCAACAAGGCAA
GGGGAGTGACACGGATTTGGCTACGTGGGTAAGGTCCGTGGTAAATGAGGACATGACGGAGGTAGATGTATTCGAGAAGGATATGAGGGG
TACAACGAATTCGGAGGGAGAAATGATGAAGTTATTGAAGATAGCTTTGGGTTGTTGTGATCTTGATATGGAAAAGAGGTTTGATATGAA
GGAAGCAATGGAAAGGATTGAGGAAGTAAAAGAGAGAGATGGGGATGATGATTTCTACTCTACAAGAGGATTATCCGATGATTATACTCA
GGTTTCGATGAACATTTAG\(3')AGAGTGTTGGTTATACATATTCATAGTTCGTGTGTAACACTTTTTTATTTGTTCAAATATCATCAT
GGTAAATATGGGATGGGACTTTATTTTGTTTGATGCATGGTTGGGGGTCGTATATATTGCTCAATGAAACCACANAAATAAATAAATATG
CAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan