ESTScan Details for Unigene SGN-U227611

Score 
598
Direction 
Forward
Predicted Peptide Sequence 
PTIDVSPFFKSDENEGAKKQAIEQIREACVSYGFFQIVNHGIPSDLLSRTIDMYKTFFGCSDEEKLCLPDNYLKSTPNSAETFEHLWFRF
PFSGFNNCRSITPHFKKVLEEIVSHFTKLGVVLEGIISECLGLPPDFLSNYRNGRSRDSLMGLHYFPATEDDNTGKPAHEDPGCFTILYQ
DEIGGLQVHKDDHWIPIPPSKDKLVVNIGDVIQVLSNNKFKSATHKVVRPIETNRYSYVFFYNVEGDKWIEPLPQFTKEIGESPKYRGFV
FEEYHELRFRNRSHPPARPEDLIHITHYSISN
Predicted Coding Sequence 
XXTCCAACAATTGATGTTTCTCCATTTTTTAAATCAGATGAAAATGAAGGAGCGAAAAAGCAGGCTATTGAGCAAATTAGAGAAGCTTGT
GTTAGCTATGGTTTCTTTCAAATTGTGAATCACGGAATTCCTTCTGACTTGTTGAGCAGAACCATCGATATGTATAAGACTTTCTTTGGC
TGTTCCGATGAAGAAAAACTGTGTTTACCTGATAATTATTTAAAAAGCACGCCGAATTCAGCTGAGACTTTTGAGCACTTGTGGTTTCGT
TTTCCATTCTCTGGCTTCAATAACTGCCGCAGCATTACACCTCATTTCAAGAAAGTATTGGAGGAGATTGTTTCCCATTTCACAAAATTA
GGAGTTGTGTTGGAAGGGATCATAAGTGAGTGTCTTGGACTCCCTCCTGACTTCCTCTCAAACTACAGAAATGGTCGTTCTCGGGACTCG
TTGATGGGGCTGCACTACTTTCCAGCGACAGAAGATGACAACACAGGAAAACCTGCACATGAAGATCCTGGCTGCTTCACTATTCTCTAC
CAGGATGAAATCGGAGGCCTTCAAGTGCACAAAGATGACCACTGGATACCCATACCGCCTTCCAAAGACAAACTAGTTGTTAACATTGGT
GATGTCATTCAGGTGCTAAGCAACAATAAATTCAAGAGTGCAACTCACAAAGTAGTGAGACCAATTGAAACAAACCGTTACTCGTACGTG
TTCTTCTATAATGTGGAAGGAGACAAGTGGATTGAGCCATTACCACAATTTACAAAGGAAATTGGAGAGTCTCCCAAGTATAGAGGATTC
GTGTTTGAAGAATATCATGAGTTGAGATTCAGAAACAGGAGTCATCCACCAGCTAGACCTGAAGATCTCATCCATATAACACACTACTCA
ATTTCTAATTAG\
Edits in Original Sequence 
(5')XXTCCAACAATTGATGTTTCTCCATTTTTTAAATCAGATGAAAATGAAGGAGCGAAAAAGCAGGCTATTGAGCAAATTAGAGAAGC
TTGTGTTAGCTATGGTTTCTTTCAAATTGTGAATCACGGAATTCCTTCTGACTTGTTGAGCAGAACCATCGATATGTATAAGACTTTCTT
TGGCTGTTCCGATGAAGAAAAACTGTGTTTACCTGATAATTATTTAAAAAGCACGCCGAATTCAGCTGAGACTTTTGAGCACTTGTGGTT
TCGTTTTCCATTCTCTGGCTTCAATAACTGCCGCAGCATTACACCTCATTTCAAGAAAGTATTGGAGGAGATTGTTTCCCATTTCACAAA
ATTAGGAGTTGTGTTGGAAGGGATCATAAGTGAGTGTCTTGGACTCCCTCCTGACTTCCTCTCAAACTACAGAAATGGTCGTTCTCGGGA
CTCGTTGATGGGGCTGCACTACTTTCCAGCGACAGAAGATGACAACACAGGAAAACCTGCACATGAAGATCCTGGCTGCTTCACTATTCT
CTACCAGGATGAAATCGGAGGCCTTCAAGTGCACAAAGATGACCACTGGATACCCATACCGCCTTCCAAAGACAAACTAGTTGTTAACAT
TGGTGATGTCATTCAGGTGCTAAGCAACAATAAATTCAAGAGTGCAACTCACAAAGTAGTGAGACCAATTGAAACAAACCGTTACTCGTA
CGTGTTCTTCTATAATGTGGAAGGAGACAAGTGGATTGAGCCATTACCACAATTTACAAAGGAAATTGGAGAGTCTCCCAAGTATAGAGG
ATTCGTGTTTGAAGAATATCATGAGTTGAGATTCAGAAACAGGAGTCATCCACCAGCTAGACCTGAAGATCTCATCCATATAACACACTA
CTCAATTTCTAATTAG\(3')ACAAAATGTTTATGTGATGAGAAATTTTCTCTCTATATGGCAAGAAACATAGCGATGATATGTATGCAG
ATCTTTTGTTTTCTTTCTTTTCCGAATAACATCAACTACTCCTTTCATATTGTTTTAGACATCAATGCATCTGTTTTATAAAATTTAACT
CCCTATTAAAGCTACATGGAATAAAGACTAATGAGATTTTTTCTCAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan