ESTScan Details for Unigene SGN-U227619

Score 
272
Direction 
Forward
Predicted Peptide Sequence 
MTYNMLINAYARGGQELRLPQLLKEMAALNLKPDSITYSTMIYAFIRVRDYKRAFYFHKQMVKNRQVPDAESYEKLRAILDVKAAIKNRK
DKSALMGIVRSSMGLLKEKKKGKKDEFW
Predicted Coding Sequence 
ATGACATACAACATGTTGATCAATGCATATGCGAGGGGAGGTCAAGAATTAAGGTTGCCACAGCTTTTGAAGGAGATGGCAGCACTTAAT
CTAAAACCTGATTCTATTACATATTCCACAATGATATATGCCTTCATCCGTGTGCGGGATTATAAGAGGGCATTTTATTTTCATAAGCAG
ATGGTAAAAAACCGGCAAGTGCCTGATGCTGAATCATATGAGAAGCTACGGGCAATTCTGGATGTAAAAGCTGCCATAAAGAACAGGAAG
GATAAAAGTGCTTTAATGGGAATAGTTAGAAGCAGTATGGGCTTATTGAAAGAAAAGAAAAAGGGAAAGAAGGATGAATTCTGG\
Edits in Original Sequence 
GTTACAACCAACAGTA(5')ATGACATACAACATGTTGATCAATGCATATGCGAGGGGAGGTCAAGAATTAAGGTTGCCACAGCTTTTGA
AGGAGATGGCAGCACTTAATCTAAAACCTGATTCTATTACATATTCCACAATGATATATGCCTTCATCCGTGTGCGGGATTATAAGAGGG
CATTTTATTTTCATAAGCAGATGGTAAAAAACCGGCAAGTGCCTGATGCTGAATCATATGAGAAGCTACGGGCAATTCTGGATGTAAAAG
CTGCCATAAAGAACAGGAAGGATAAAAGTGCTTTAATGGGAATAGTTAGAAGCAGTATGGGCTTATTGAAAGAAAAGAAAAAGGGAAAGA
AGGATGAATTCTGG\(3')AAAAATAGAAAAAAAGGATCGAGATTTCAAGGACAGTAGTAGCTATATTTTTTGTCTTTGTCATTACCTAA
TCAACTTTCAGTGAGTTAGCTTAGAATTTTCCTATTTCTTTTGGTGGTTATCTTCAATCCAGCCTGATTGAGATGCTCATTTGTAAAGTT
GTATTCTACCTTTTAGCATAAAAGAGGAGACATTGACTTAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan