Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U227666

Score 
503
Direction 
Forward
Predicted Peptide Sequence 
MEFVSNNNGVSCYYDVLGICKQASQSEIRCAYRKLALKWHPDRWMKKDPCIMGEAKHRFQQVQEAYSVLSEKRKKSLYDTKLLQLMGDDS
DDDKEFCEFMQEXDNNVGTEKSKGENTLEELQKQFLDMTSEFDKFSEFSFSFDESLNGNMPKKRRLYHP
Predicted Coding Sequence 
ATGGAATTTGTGTCCAACAATAATGGAGTCTCTTGCTACTATGATGTTCTTGGAATTTGTAAACAAGCCTCACAGTCAGAAATTCGTTGT
GCTTACAGAAAGCTTGCTCTGAAATGGCACCCAGATAGATGGATGAAGAAGGATCCTTGCATTATGGGAGAAGCTAAACATAGATTTCAA
CAAGTTCAGGAAGCTTATTCTGTTCTCTCAGAGAAAAGGAAAAAATCACTATATGACACTAAGTTGCTTCAACTCATGGGAGATGATTCT
GATGATGATAAAGAATTTTGTGAGTTTATGCAAGAAAXTGATAACAATGTTGGAACTGAGAAATCTAAGGGAGAAAACACATTGGAGGAA
CTTCAAAAGCAGTTTTTAGACATGACAAGTGAATTTGATAAATTTTCAGAATTTAGTTTCTCCTTTGATGAATCTCTTAATGGCAACATG
CCCAAAAAGAGACGTCTATATCACCCTTGA\
Edits in Original Sequence 
GCACGAGCGGCACGAGATTATATTCACCAAATAAAATAAAATTTCTCCCCCTTTTTTTTGGGGTTCAAGAAA(5')ATGGAATTTGTGTC
CAACAATAATGGAGTCTCTTGCTACTATGATGTTCTTGGAATTTGTAAACAAGCCTCACAGTCAGAAATTCGTTGTGCTTACAGAAAGCT
TGCTCTGAAATGGCACCCAGATAGATGGATGAAGAAGGATCCTTGCATTATGGGAGAAGCTAAACATAGATTTCAACAAGTTCAGGAAGC
TTATTCTGTTCTCTCAGAGAAAAGGAAAAAATCACTATATGACACTAAGTTGCTTCAACTCATGGGAGATGATTCTGATGATGATAAAGA
ATTTTGTGAGTTTATGCAAGAAAXTGATAACAATGTTGGAACTGAGAAATCTAAGGGAGAAAACACATTGGAGGAACTTCAAAAGCAGTT
TTTAGACATGACAAGTGAATTTGATAAATTTTCAGAATTTAGTTTCTCCTTTGATGAATCTCTTAATGGCAACATGCCCAAAAAGAGACG
TCTATATCACCCTTGA\(3')TTATGTACATTTATTTTCTTATTGATTCTAAAGTTGCTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan