Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U227741

Score 
239
Direction 
Forward
Predicted Peptide Sequence 
ENPHFFNPKNPFRLTVRFSSFPLFPAEXGLNCSKLVNGVSCSTVGSGNLVRSIXKINKISPIQAALPTSGSELASFARKFIVALLHRPVP
XLAPVLEAKSDPILPNPEAITDRREKEPEASVWVIHATFQKTTQWKVYGXGNLKKEDPIELPLIEFEVIASATNNFNEENKLGEGGFGPV
FKGKX
Predicted Coding Sequence 
GAAAACCCCCATTTTTTCAACCCTAAAAACCCGTTTCGTCTTACTGTTCGATTCTCCTCTTTTCCACTGTTCCCAGCAGAAXTAGGACTC
AATTGCTCAAAATTGGTTAATGGTGTTTCGTGTAGTACCGTTGGCTCTGGGAATTTGGTGAGATCGATTAAXAAGATCAATAAAATATCC
CCCATTCAAGCTGCACTTCCAACAAGTGGCTCAGAGTTGGCAAGTTTTGCCAGGAAGTTTATTGTAGCCCTCCTTCACCGTCCAGTTCCA
GXTTTGGCACCTGTACTCGAAGCTAAATCAGATCCTATCTTACCAAACCCCGAAGCTATAACGGACAGAAGAGAAAAGGAGCCAGAAGCT
TCAGTCTGGGTGATTCATGCTACATTTCAAAAGACTACACAGTGGAAAGTTTATGGAXTTGGTAATTTAAAGAAAGAAGATCCAATTGAA
CTTCCACTGATTGAATTTGAGGTAATTGCCTCAGCAACAAACAACTTCAATGAAGAAAACAAACTCGGGGAAGGAGGTTTTGGTCCAGTT
TTCAAGGGAAAGCXX\
Edits in Original Sequence 
(5')GAAAACCCCCATTTTTTCAACCCTAAAAACCCGTTTCGTCTTACTGTTCGATTCTCCTCTTTTCCACTGTTCCCAGCAGAAXTAGG
ACTCAATTGCTCAAAATTGGTTAATGGTGTTTCGTGTAGTACCGTTGGCTCTGGGAATTTGGTGAGATCGATTAAXAAGATCAATAAAAT
ATCCCCCATTCAAGCTGCACTTCCAACAAGTGGCTCAGAGTTGGCAAGTTTTGCCAGGAAGTTTATTGTAGCCCTCCTTCACCGTCCAGT
TCCAGXTTTGGCACCTGTACTCGAAGCTAtAATCAGATCCTATCTTACCAAACCCCGAAGCTATAACGGACAGAAGAGAAAAGGAGCCAG
AAGCTTCAGTCTGGGTGATTCATGCTACATTTCAAAAGACTACACAGTGGAAAGTTTATGGAXTTGGTAATTTAAAGAAAGAAGATCCAA
TTGAACTTCCACTGATTGAATTTGAGGTAATTGCCTCAGCAACAAACAACTTCAATGAAGAAAACAAACTCGGGGAAGGAGGTTTTGGTC
CAGTTTTCAAGGGAAAGCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan