ESTScan Details for Unigene SGN-U227762

Score 
777
Direction 
Forward
Predicted Peptide Sequence 
MGKTLIGSTLGXVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLNEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGKNF
TYVLQVKDQIGSFYYFPSLAFHKAAGGFGSINIASRSVIPVPFPPPAGEFSILTGDWFKQNHSDLKAILDGGNDLPFPDGLLINGHGSNG
YTFTVDQGKTYRFRISNVGLTTSVNFXNQGHKMTVVEVEGTHTVQNAYDSLDIHLGQSYS
Predicted Coding Sequence 
ATGGGGAAGACCCTTATAGGTTCTACACTTGGAXATGTTACTTATGGTGATATTTACCCCCTTGGTGTCAAACAACAGGGGATTTTGATA
AATGGGCAATTTCCAGGACCACCTATTCAGTGTGTGACCAATGATAACTTGATTATCAATGTTTTCAACAATTTGAATGAACCCTTTCTC
ATTTCCTGGAATGGTGTGGAGCAGAGGAGAAATTCATGGCAGGATGGAGTCTATGGCACTAATTGTCCCATTCCACCAGGGAAAAACTTC
ACTTATGTTCTCCAAGTCAAAGATCAGATTGGTAGTTTCTACTACTTCCCTTCCCTTGCTTTCCACAAAGCAGCAGGAGGATTTGGTAGC
ATAAATATCGCCAGTCGTTCTGTTATTCCTGTTCCTTTTCCTCCTCCTGCTGGAGAGTTCTCCATACTGACTGGAGATTGGTTCAAACAA
AATCACAGTGACCTTAAAGCAATTTTGGATGGTGGAAATGATCTTCCCTTCCCTGACGGGCTTCTTATCAACGGTCATGGATCAAATGGT
TATACGTTCACCGTTGATCAAGGCAAGACTTACAGATTCAGGATATCAAATGTTGGTCTCACAACTTCCGTTAATTTTAXGAATCAAGGG
CATAAGATGACTGTAGTTGAAGTAGAAGGGACTCACACTGTGCAAAATGCATATGATTCTCTTGATATCCATTTGGGACAGTCCTATTCC
\
Edits in Original Sequence 
ATCATTCACACACAAACAAAAGAAAAAAAAATATGGTAAAAGAATGGAGTACTTGGTTGCCTTTAATGGCTATGGTGTTGATGTTTCTTC
ATGTAAATTTTATTC
(5')ATGGGGAAGACCCTTATAGGTTCTACACTTGGAXATGTTACTTATGGTGATATTTACCCCCTTGGTGTCAA
ACAACAGGGGATTTTGATAAATGGGCAATTTCCAGGACCACCTATTCAGTGTGTGACCAATGATAACTTGATTATCAATGTTTTCAACAA
TTTGAATGAACCCTTTCTCATTTCCTGGAATGGTGTGGAGCAGAGGAGAAATTCATGGCAGGATGGAGTCTATGGCACTAATTGTCCCAT
TCCACCAGGGAAAAACTTCACTTATGTTCTCCAAGTCAAAGATCAGATTGGTAGTTTCTACTACTTCCCTTCCCTTGCTTTCCACAAAGC
AGCAGGAGGATTTGGTAGCATAAATATCGCCAGTCGTTCTGTTATTCCTGTTCCTTTTCCTCCTCCTGCTGGAGAGTTCTCCATACTGAC
TGGAGATTGGTTCAAACAAAATCACAGTGACCTTAAAGCAATTTTGGATGGTGGAAATGATCTTCCCTTCCCTGACGGGCTTCTTATCAA
CGGTCATGGATCAAATGGTTATACGTTCACCGTTGATCAAGGCAAGACTTACAGATTCAGGATATCAAATGTTGGTCTCACAACTTCCGT
TAATTTTAXGAATCAAGGGCATAAGATGACTGTAGTTGAAGTAGAAGGGACTCACACTGTGCAAAATGCATATGATTCTCTTGATATCCA
TTTGGGACAGTCCTATTCC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan