ESTScan Details for Unigene SGN-U227810

Score 
261
Direction 
Forward
Predicted Peptide Sequence 
VIEGGNGGSGLQMPANYGDYFIGPGFEQLIQNLAENDPNRYGTPPASRAAVEGLPTIKVDEELMRSELAQCAVCKDDFEMGSDGYRCLVS
MFIIRIVSYRGLSCTVLARFVAXELPTDEPENENRQRDNDGDSSGDGSASGSGGSGRRFTTISLPWPLGSFGASSARDDPSLVGSGTGSL
IRWYPCLQVVSWMTKLEELLGR
Predicted Coding Sequence 
XTCGTTATCGAGGGGGGTAACGGGGGTAGTGGTCTCCAAATGCCGGCGAATTATGGGGACTATTTCATTGGACCGGGGTTTGAGCAATTG
ATCCAGAATTTGGCAGAAAATGATCCAAACCGATATGGGACTCCTCCGGCGTCGAGAGCAGCGGTGGAGGGGCTCCCTACCATCAAAGTT
GATGAGGAATTGATGCGTTCTGAACTGGCACAGTGTGCTGTTTGTAAGGATGATTTTGAGATGGGGTCAGATGGATACAGATGCCTTGTA
AGCATGTTTATCATAAGGATTGTATCATACCGTGGCTTGAGTTGCACAGTTCTTGCCCGGTTTGTCGCTXATGAGTTGCCAACGGATGAG
CCTGAGAATGAGAACAGGCAAAGAGACAATGATGGGGACTCGAGCGGGGATGGTTCTGCTTCTGGAAGTGGGGGATCAGGGAGAAGGTTT
ACTACAATATCATTGCCATGGCCTTTGGGAAGCTTTGGAGCATCATCTGCCAGGGATGATCCGAGTCTCGTGGGCAGCGGAACAGGGAGT
CTAATTAGGTGGTATCCTTGCTTGCAGGTTGTATCATGGATGACAAAGTTGGAGGAGTTGTTGGGTAGATAA\
Edits in Original Sequence 
(5')XTCGTTATCGAGGGGGGTAACGGGGGTAGTGGTCTCCAAATGCCGGCGAATTATGGGGACTATTTCATTGGACCGGGGTTTGAGCA
ATTGATCCAGAATTTGGCAGAAAATGATCCAAACCGATATGGGACTCCTCCGGCGTCGAGAGCAGCGGTGGAGGGGCTCCCTACCATCAA
AGTTGATGAGGAATTGATGCGTTCTGAACTGGCACAGTGTGCTGTTTGTAAGGATGATTTTGAGATGGGGTCAGATGtGATACAGATGCC
TTGTAAGCATGTTTATCATAAGGATTGTATCATACCGTGGCTTGAGTTGCACAGTTCTTGCCCGGTTTGTCGCTXATGAGTTGCCAACGG
ATGAGCCTGAGAATGAGAACAGGCAAAGAGACAATGATGGGGACTCGAGCGGGGATGGTTCTGCTTCTGGAAGTGGGGGATCAGGGAGAA
GGTTTACTACAATATCATTGCCATGGCCTTTGGGAAGCTTTGGAGCATCATCTaGCCAGGGATGATCCGAGTCTCGTGGGCAGCGGAACA
GGGAGTCTAATTAGGTGGTATCCTTGCTTGCAGGTTGTATCATGGATGACAAAGTTGGAGGAGTTGTTGGGTAGATAA\(3')TTAGAAA
ATGCTACAAAGGTAAAGGATTAGGTTTCATCTCTTAAAACATAGATACAGGGTCTACACAAACCCCAGATAGTATTGCAAGATGTTTGTC
TGAATGTTTTGCATCAGATGTCCAAAGTTTTCATTTATGCTTCATCAATCGCGAATTTTGCGGATTGTTTTAGTCCTTGTGCAGTTGATC
TGGAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan