ESTScan Details for Unigene SGN-U227856

Score 
693
Direction 
Forward
Predicted Peptide Sequence 
LCMFLLGKVEECIQRLVDSNRVPEAAFMARSYLPSKVSEIVAIWKKDLSKVNQKAAEALADPEEYPNMFEHWQVACAVESKVAEERGGGY
PPATEYVNHADRSTNNLVEAFSNMKMDEESLENGDIDHDVAEQSGDEVQELGQDDEQNEGQEEPVVVDADSTDSAVLINETEAEEEWGTN
TEGKPVSLKAIGWAGXENPSFGAXAYTTSLGSFKTVPSVGSVSVSLKGAINGVGMSAVLQVVDFVALSFVGILDICFQLVVSFXSLIVAL
SYSFEATFFTLQYLHMSLPTVETL
Predicted Coding Sequence 
XTCCTTTGCATGTTTCTTTTGGGTAAAGTGGAGGAATGCATTCAGCGATTGGTTGATAGCAATCGGGTACCTGAGGCTGCTTTTATGGCT
AGATCTTATCTGCCAAGTAAGGTTTCTGAAATAGTTGCAATTTGGAAGAAGGACCTCAGTAAGGTTAACCAGAAAGCAGCAGAAGCTTTG
GCTGATCCTGAAGAATATCCTAATATGTTTGAGCACTGGCAAGTTGCATGTGCTGTTGAATCTAAAGTTGCAGAAGAAAGGGGTGGTGGC
TACCCACCAGCAACAGAATATGTAAATCATGCTGATAGATCAACTAACAACCTTGTAGAAGCTTTCAGCAACATGAAAATGGATGAAGAA
TCTCTTGAAAATGGAGATATAGACCACGACGTTGCAGAACAGAGTGGTGATGAGGTGCAAGAACTGGGGCAAGATGATGAACAAAATGAG
GGACAAGAAGAGCCTGTAGTTGTGGATGCTGATTCTACTGACAGTGCGGTACTCATTAATGAAACTGAGGCAGAAGAAGAGTGGGGTACG
AATACTGAAGGAAAACCXGTCAGCCTAAAAGCAATTGGTTGGGCCGGTGXTGAAAATCCTAGTTTTGGTGCTGXTGCTTACACCACGTCA
CTAGGCTCATTCAAGACAGTTCCATCTGTAGGTTCAGTCAGTGTTTCCTTAAAAGGGGCGATTAACGGAGTGGGCATGTCTGCTGTTCTG
CAAGTGGTTGATTTTGTAGCATTGAGTTTTGTAGGCATACTGGACATATGTTTCCAGCTGGTTGTTAGCTTTAXGTCACTCATAGTTGCT
TTATCATATTCTTTTGAGGCAACGTTTTTCACCCTTCAATATCTTCATATGTCATTGCCCACTGTAGAAACACTATAA\
Edits in Original Sequence 
(5')XTCCTTTGCATGTTTCTTTTGGGTAAAGTGGAGGAATGCATTCAGCGATTGGTTGATAGCAATCGGGTACCTGAGGCTGCTTTTAT
GGCTAGATCTTATCTGCCAAGTAAGGTTTCTGAAATAGTTGCAATTTGGAAGAAGGACCTCAGTAAGGTTAACCAGAAAGCAGCAGAAGC
TTTGGCTGATCCTGAAGAATATCCTAATATGTTTGAGCACTGGCAAGTTGCATGTGCTGTTGAATCTAAAGTTGCAGAAGAAAGGGGTGG
TGGCTACCCACCAGCAACAGAATATGTAAATCATGCTGATAGATCAACTAACAACCTTGTAGAAGCTTTCAGCAACATGAAAATGGATGA
AGAATCTCTTGAAAATGGAGATATAGACCACGACGTTGCAGAACAGAGTGGTGATGAGGTGCAAGAACTGGGGCAAGATGATGAACAAAA
TGAGGGACAAGAAGAGCCTGTAGTTGTGGATGCTGATTCTACTGACAGTGCGGTACTCATTAATGAAACTGAGGCAGAAGAAGAGTGGGG
TACGAATACTGAAGGAAAACCXGTCAGCCTAAAAGCAATTGGTTGGGCCGGTGXTGAAAATCCTAGTTTTGGTGCTGXTGCTTACACCAC
GTCACTAGGCTCATTCAAGACAGTTCCATCTGTAGGTTCAGTCAGTGTTTCCTTaAAAAGGGGCGATTAACGGAGTGGGCATGTCTGCTG
TTCTGCAAGTGGTgTGATTTTGTAGCATTGAGTTTTGTAGGCATACTGGACATATGTTTCCAGCTGGTTGTTAGCTTTAXGTCACTCATA
GTTGCTTTATCATATTCTTTTGAGGCAtACGTTTTTCACCCTTCAATATCTTCATATGTCATTGCCCACTGTAGAAACACTATAA\(3')
GCCATATATAGAAGTGGAGGTAATGCAGATGTGTGCTCAAAAACTGCAATCTGAAGAAATGAAAATGATAATCAGGATATTTTGTTTGGT
GCATTTTTGTGGAACTATGGGAAGAAAGAAGAAACTTACCAAGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan