ESTScan Details for Unigene SGN-U227917

Score 
323
Direction 
Forward
Predicted Peptide Sequence 
MMLSRISRSISKASRSSIHKGVGYGVRSTVLDEVATGGACITRVDGGLGFVRTYLTLIGGGRRGLSKELDSVLASPRLRRFFCSEGPKRR
NYENYYPKNKKEIPKANNNQKAESGKEEGSSEQGNPQENFIKLNYNLLAPLLFIGFILSSILMS
Predicted Coding Sequence 
ATGATGCTTTCACGTATTAGCCGCTCCATATCTAAGGCTTCTCGTTCCAGCATTCACAAAGGTGTTGGATATGGAGTGAGGTCGACGGTG
TTGGATGAAGTGGCAACCGGTGGCGCGTGCATTACACGCGTTGATGGTGGGTTAGGGTTTGTGAGAACGTATTTGACGTTGATTGGAGGT
GGAAGGAGAGGTTTGAGTAAGGAGCTTGATTCGGTTTTGGCAAGCCCTAGGCTTAGGAGGTTTTTCTGTAGCGAAGGGCCAAAGAGAAGA
AACTATGAGAACTATTATCCAAAGAACAAGAAAGAAATTCCCAAAGCAAATAATAATCAAAAGGCTGAGTCAGGCAAAGAGGAAGGTTCA
AGTGAGCAAGGAAATCCCCAAGAGAACTTCATTAAGCTAAACTACAATTTACTAGCACCCTTATTATTTATTGGGTTTATTCTGTCATCT
ATCCTCATGTCT\
Edits in Original Sequence 
AAATTCTTCGACCTAAACAATAGCTCCAAATGCAAAAAATCTTATAAATCTGTGAAAATTAAACTGTTTTTTTTGCTAATTTCTCGTCGA
TATTATCTATCGATTTGCCTTAAAGGATCCGTTTTTCAGAATCGATTTCTAAGGATTTGAAAAGGAAATTCATGTTAAGGAAATCACCAA
AAAA
(5')ATGATGCTTTCACGTATTAGCCGCTCCATATCTAAGGCTTCTCGTTCCAGCATTCACAAAGGTGTTGGATATGGAGTGAGGT
CGACGGTGTTGGATGAAGTGGCAACCGGTGGCGCGTGCATTACACGCGTTGATGGTGGGTTAGGGTTTGTGAGAACGTATTTGACGTTGA
TTGGAGGTGGAAGGAGAGGTTTGAGTAAGGAGCTTGATTCGGTTTTGGCAAGCCCTAGGCTTAGGAGGTTTTTCTGTAGCGAAGGGCCAA
AGAGAAGAAACTATGAGAACTATTATCCAAAGAACAAGAAAGAAATTCCCAAAGCAAATAATAATCAAAAGGCTGAGTCAGGCAAAGAGG
AAGGTTCAAGTGAGCAAGGAAATCCCCAAGAGAACTTCATTAAGCTAAACTACAATTTACTAGCACCCTTATTATTTATTGGGTTTATTC
TGTCATCTATCCTCATGTCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan