Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U228011

Score 
96
Direction 
Forward
Predicted Peptide Sequence 
MGYVKLVFLMLFSLLCQLAFCSSSSHLCPKDQALALLQFKQMFKISRYVSGNCFDEKANRFSHIRKLFRGTRAQIVALGMEFIXDETTGK
VIELNLTCSKLQGKFHSNSSVFQLSNLKRLDLSNNNFSGSYISPKFGEFSSLTHLHLSYSSFIGRIPVEISRLSELQVLHIRGYSYELRF
EPHNFELLLKNLTRLRELHLSDVNISSAIPLNFSSHXNKSKTSEHAVIRDAA
Predicted Coding Sequence 
ATGGGTTACGTAAAACTTGTTTTTTTAATGCTATTTTCCTTACTCTGTCAACTTGCTTTCTGCTCGTCCTCATCTCATTTGTGCCCCAAA
GATCAAGCTCTTGCTCTTCTACAATTCAAGCAAATGTTTAAAATAAGTCGTTATGTTTCCGGTAACTGTTTCGACGAAAAGGCCAACCGA
TTCAGTCATATCCGCAAACTCTTTCGTGGAACAAGAGCACAGATTGTTGCTCTTGGGATGGAGTTTATTGXTGACGAGACGACTGGAAAA
GTGATTGAGCTTAACCTCACTTGCAGCAAACTTCAAGGCAAATTTCACTCAAACAGTAGTGTCTTTCAACTCTCCAATCTCAAAAGGCTT
GATTTGTCTAATAATAATTTCTCTGGATCGTACATTTCGCCTAAATTTGGTGAGTTTTCTAGTTTGACGCATCTTCATTTGTCGTATTCG
AGTTTTATAGGTCGAATCCCAGTAGAAATCTCTCGTCTTTCGGAATTACAAGTTCTTCATATCCGGGGTTATTCGTATGAGCTTAGATTC
GAACCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCGATTAAGAGAGCTCCACCTTAGCGATGTAAACATCTCTTCCGCTATTCCT
CTGAATTTCTCTTCTCATTTXAACAAATCTAAGACTTCGGAACACGCAGTTATACGGGATGCTGCX\
Edits in Original Sequence 
ATTTTTGATTTCTTATCTACCAACTTAATTAGTTTTGAACATTTTTAGTGCAGAA(5')ATGGGTTACGTAAAACTTGTTTTTTTAATGC
TATTTTCCTTACTCTGTCAACTTGCTTTCTGCTCGTCCTCATCTCATTTGTGCCCCAAAGATCAAGCTCTTGCTCTTCTACAATTCAAGC
AAATGTTTAAAATAAGTCGTTATGTTTCCGGTAACTGTTTCGACGtAAAAGGCCAACCGATTCAGTCATATCCGCAAACTCTTTCGTGGA
ACAAGAGCACAGATTGTTGCTCTTGGGATGGAGTTTATTGXTGACGAGACGACTGGAAAAGTGATTGAGCTTAACCTCACTTGCAGCAAA
CTTCAAGGCAAATTTCACTCAAACAGTAGTGTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTAATAATAATTTCTCTGGATCG
TACATTTCGCCTAAATTTGGTGAGTTTTCTAGTTTGACGCATCTTCATTTGTCGTATTCGAGTTTTATAGGTCGAATCCCAGTAGAAATC
TCTCGTCTTTCGGAATTACAAGTTCTTCATATCCGGGGTTATTCGTATGAGCTTAGATTCGAACCTCACAATTTTGAACTGCTCCTTAAG
AACTTGACCCGATTAAGAGAGCTCCACCTTAGCGATGTAAACATCTCTTCCGCTATTCCTCTGAATTTCTCTTCTCATTTXAACAAATCT
AAGACTTCGGAACACGCAGTTATACGGGATGCTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan