ESTScan Details for Unigene SGN-U228030

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
EQNSSFSRLLYPNLDXPKMTNQAESSDSKGAKKDFSTAILERKKSPNRLVVDEAVNDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDT
VVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGLTGDLFDAVPETVLFGSISSFEEGDNFLVRGG
MRSVEFKVIETDPGEYCVVX
Predicted Coding Sequence 
XTCGAGCAAAACTCCAGTTTCTCTCGGCTGCTCTACCCTAATCTAGATXCTCCGAAGATGACTAACCAGGCCGAGTCATCTGACTCAAAA
GGTGCGAAGAAGGATTTCTCTACCGCGATTTTGGAGAGGAAGAAGTCTCCTAATCGGCTTGTTGTTGATGAGGCGGTCAACGATGATAAC
TCTGTTGTTGCACTGCACCCTGCTACTATGGAGAAGCTACAGCTCTTCCGTGGAGATACAATTCTCATCAAGGGAAAGAAAAGGAAGGAT
ACAGTTGTCATTGCTCTTGCTGATGAAACATGTGATGAGCCAAAGATTAGGATGAACAAGGTTGTCCGTTCAAATTTGAGGGTCCGTCTT
GGAGATGTTGTGTCTGTGCACCAATGCCCAGATGTTAAGTATGGGAAGCGTGTCCACATACTTCCTATAGATGATACAATAGAAGGTCTC
ACCGGGGATTTGTTTGATGCXGTTCCTGAAACCGTACTTTTTGGAAGCATATCGTCCTTTGAGGAAGGAGACAATTTTCTTGTTAGAGGG
GGGATGAGAAGTGTGGAATTCAAAGTCATTGAGACTGACCCAGGGGAGTATTGTGTTGTTGXX\
Edits in Original Sequence 
(5')XTCGAGCAAAACTCCAGTTTCTCTCGGCTGCTCTACCCTAATCTAGATXCTCCGAAGATGACTAACCAGGCCGAGTCATCTGACTC
AAAAGGTGCGAAGAAGGATTTCTCTACCGCGATTTTGGAGAGGAAGAAGTCTCCTAATCGGCTTGTTGTTGATGAGGCGGTCAACGATGA
TAACTCTGTTGTTGCACTGCACCCTGCTACTATGGAGAAGCTACAGCTCTTCCGTGGAGATACAATTCTCATCAAGGGAAAGAAAAGGAA
GGATACAGTTGTCATTGCTCTTGCTGATGAAACATGTGATGAGCCAAAGATTAGGATGAACAAGGTTGTCCGTTCAAATTTGAGGGTCCG
TCTTGGAGATGTTGTGTCTGTGCACCAATGCCCAGATGTTAAGTATGGGAAGCGTGTCCACATACTTCCTATAGATGATACAATAGAAGG
TCTCACCGGGGATTTGTTTGATGCXGTTCCTGAAACCGTACTTTTTGGAAGCATATCGTCCTTTGAGGaAAGGAGACAATTTTCTTGTTA
GAGGGGGGATGAGAAGTGTGGAATTCAAAGTCATTGAGACTGACCCAGGGGAGTATTGTGTTGTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan