ESTScan Details for Unigene SGN-U228119

Score 
189
Direction 
Reverse
Predicted Peptide Sequence 
MAGSYFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP
Predicted Coding Sequence 
ATGGCTGGTTCATATTTTTGTGATTCGAAGTGCAAGCTGAGATGTTCAAAGGCAGGACTTGCGGACAGATGCTTGAAATACTGTGGAATT
TGTTGTGAAGAATGCAAATGCGTGCCTTCTGGAACTTATGGTAACAAACATGAATGTCCTTGTTATAGGGACAAGAAGAACTCTAAGGGC
AAGTCTAAATGCCCTTGA\
Edits in Original Sequence 
TTAGAAAAAATGAAGTTATTTCTATTAACTCTGCTTTTGGTCACTCTTGTTATTACCCCTTCTTTCATTCAAACTACT(5')ATGGCTGG
TTCATATTTTTGTGATTCGAAGTGCAAGCTGAGATGTTCAAAGGCAGGACTTGCGGACAGATGCTTGAAATACTGTGGAATTTGTTGTGA
AGAATGCAAATGCGTGCCTTCTGGAACTTATGGTAACAAACATGAATGTCCTTGTTATAGGGACAAGAAGAACTCTAAGGGCAAGTCTAA
ATGCCCTTGA\(3')ATTTGATGTATTTTAAATATCTAAGTGGTTAAATTTGGTCTTTACATATTAAGTTTTCTAGGTATGTTAAAGTTA
TACATATAATTTGAAAACTAGAAGAAAAAAAAAAGTTTGTTATATTAATAAATAAATGGGTTCTTCTTTGAACTCTTAGGGTAATTTTCT
GATTTGTTATAAATGTAATATGATTTTGAATTCCCATAAATAATAATTTACTGTTTGGTTAAGTAGAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan