ESTScan Details for Unigene SGN-U228173

Score 
420
Direction 
Forward
Predicted Peptide Sequence 
PEFFGLREMVATRRSGSLPSTVKRSASSSDDSSSKRQKVVDNNNNNNNAESSEKPKSPPPTENPKELSSTDPPEFAAVTAPDGETTAVPA
AKGEDAPSVSVVATPIAEGATPAIVDXAQEFGDFEEAESRFGNNIALVRLISEFPQNPTIHVSATNFLIGSSKNAHLPIKQQTVSATLCS
Predicted Coding Sequence 
XXTCCAGAGTTTTTTGGTCTCCGGGAAATGGTTGCGACGAGACGAAGTGGATCTCTGCCGTCGACTGTTAAACGGTCGGCCTCCTCCTCC
GATGATTCTTCTTCTAAGCGACAAAAGGTGGTAGATAATAATAACAATAATAATAATGCGGAGTCGTCGGAGAAACCCAAGTCTCCTCCA
CCGACGGAGAATCCCAAGGAGTTGTCTTCTACTGACCCGCCGGAATTCGCCGCCGTTACAGCTCCCGACGGTGAGACCACCGCCGTTCCC
GCCGCGAAGGGTGAAGATGCACCTTCCGTATCCGTTGTAGCAACTCCTATTGCAGAAGGGGCGACGCCTGCTATAGTTGATAXAGCCCAG
GAGTTCGGTGACTTTGAGGAAGCTGAATCAAGGTTCGGAAACAACATCGCCTTGGTGAGGCTTATATCAGAGTTTCCTCAGAACCCAACT
ATTCATGTTTCAGCTACAAATTTCTTGATTGGTTCTAGCAAAAATGCTCATCTTCCTATCAAGCAACAAACAGTTAGTGCAACCTTATGT
TCX\
Edits in Original Sequence 
(5')XXTCCAGAGTTTTTTGGTCTCCGGGAAATGGTTGCGACGAGACGAAGTGGATCTCTGCCGTCGACTGTTAAACGGTCGGCCTCCTC
CTCCGATGATTCTTCTTCTAAGCGACAAAAGGTGGTAGATAATAATAACAATAATAATAATGCGGAGTCGTCGGAGAAACCCAAGTCTCC
TCCACCGACGGAGAATCCCAAGGAGTTGTCTTCTACTGACCCGCCGGAATTCGCCGCCGTTACAGCTCCCGACGGTGAGACCACCGCCGT
TCCCGCCGCGAAGGGTGAAGATGCACCTTCCGTATCCGTTGTAGCAACTCCTATTGCAGAAGGGGCGACGCCTGCTATAGTTGATAXAGC
CCAGGAGTTCGGTGACTTTGAGGAAGCTGAATCAAGGTTCGGAAACAACATCGCCTTGGTGtAGGCTTATATCAGAGTTTCCTCAGAACC
CAACTATTCATGTTTCAGCTACAAATTTCTTGATTGGTTCTAGCAAAAATGCTCATCTTCCTATCAAGCAACAAACAGTTAGTGCAACCT
TATGTTCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan