ESTScan Details for Unigene SGN-U228196

Score 
289
Direction 
Forward
Predicted Peptide Sequence 
MGLNGVDLTDDGDGGGGDVGGGEDKASVVSCSICLEAVTDNGDDPGRSFNVDINFILIALVLPLTSRGKCSVPTVGKXEKGQWLYASGCR
PLPDFNMEDWAHEEDLYDLSYTE
Predicted Coding Sequence 
ATGGGATTGAATGGTGTGGATCTTACGGATGACGGCGACGGAGGAGGAGGAGATGTTGGTGGAGGAGAAGATAAGGCATCGGTGGTTTCG
TGTTCGATTTGTCTTGAAGCTGTAACCGACAATGGGGATGATCCTGGTCGAAGCTTCAATGTGGACATCAATTTCATCTTGATTGCATTG
GTTCTGCCTTTAACATCAAGGGGCAAATGCAGTGTCCCAACTGTCGGAAAAXTTGAGAAGGGTCAATGGCTATATGCAAGTGGTTGCCGT
CCCCTACCAGATTTTAACATGGAAGATTGGGCCCATGAAGAAGACCTATATGATCTGAGCTACACTGAA\
Edits in Original Sequence 
TTTTTAGGAAAATAGAAAGAAAAAGAGGTTCACAGTTTTTGTACAGCCTCATCCATCTTCTCGTCTCTTCTCTTCTCTTCTCACCTATCA
CCAAATCGCTTCCTCAATATTCCGAGACCCTTTTGCTTAGCCTTCTTAATCGGATTCTCCTCATCTTTTTTTCTTACATACCCCCCCTTT
TCTTTTTTCATCAACAAAGATCAACGCAAGATTACCGTTTTTCTTTTTTCTTCTTTTCTTCTTTTTGCTAGGAGTAAACCAAGTTGTTGT
AGCTTGTGTTTGACAGTAAATT
(5')ATGGGATTGAATGGTGTGGATCTTACGGATGACGGCGACGGAGGAGGAGGAGATGTTGGTGGAG
GAGAAGATAAGGCATCGGTGGTTTCGTGTTCGATTTGTCTTGAAGCTGTAACCGACAATGGGGATaGATCCTGGTCGAAGCTTCAATGTG
GACATCAATTTCATCTTGATTGCATTGGTTCTGCCTTTAACATCAAGGGGCAAATGCAGTGTCCCAACTGTCGGAAAAXTTGAGAAGGGT
CAATGGCTATATGCAAGTGGTTGCCGTCCCCTACCAGATTTTAACATGGAAGATTGGGCCCATGAAGAAGACCTATATGATCTGAGCTAC
ACTGAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan