ESTScan Details for Unigene SGN-U228234

Score 
487
Direction 
Forward
Predicted Peptide Sequence 
MPSRISDSCRPHHSQKHFDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNNNILDHIGHACKKWGAFQIINHSISE
KLLRDIEVAGKTLFSLPMQQKLKAARSPDGVTGYGAARISSFFSKLMWSEGITIDGSPIEHA
Predicted Coding Sequence 
ATGCCTTCAAGAATCTCAGATTCCTGTAGACCTCATCACTCTCAAAAACACTTTGACTTGAACTCAATTAAAGAATTACCAGAATCCCAT
GCATGGACATCATCAAATGATCATTATACTCAAGAAAATTCATGTAATTTCGAGTCTATTCCAGTGATCGACCTCGATAACAACAATAAC
AATAATAATAATAACAATATTCTTGATCATATAGGTCATGCATGCAAGAAATGGGGTGCATTTCAAATTATAAACCATAGTATATCAGAG
AAATTACTACGAGATATTGAAGTGGCTGGAAAAACCCTATTTTCACTTCCTATGCAACAAAAATTAAAGGCTGCTCGCTCTCCTGATGGT
GTCACTGGCTATGGCGCAGCTCGAATTTCGTCTTTTTTCTCGAAGCTCATGTGGTCTGAAGGGATCACCATTGATGGTTCCCCAATTGAA
CATGCT\
Edits in Original Sequence 
CCCTTTGTTCTTCCATCTACTATAGCTCATAAAGTAATCTAATTTTTTTTATATATATAAATTTTTCATTACGTACCACACT(5')ATGC
CTTCAAGAATCTCAGATTCCTGTAGACCTCATCACTCTCAAAAACACTTTGACTTGAACTCAATTAAAGAATTACCAGAATCCCATGCAT
GGACATCATCAAATGATCATTATACTCAAGAAAATTCATGTAATTTCGAGTCTATTCCAGTGATCGACCTCGATAACAACAATAACAATA
ATAATAATAACAATATTCTTGATCATATAGGTCATGCATGCAAGAAATGGGGTGCATTTCAAATTATAAACCATAGTATATCAGAGAAAT
TACTACGAGATATTGAAGTGGCTGGAAAAACCCTATTTTCACTTCCTATGCAACAAAAATTAAAGGCTGCTCGCTCTCCTGATGGTGTCA
CTGGCTATGGCGCAGCTCGAATTTCGTCTTTTTTCTCGAAGCTCATGTGGTCTGAAGGGATCACCATTGATGGTTCCCCAATTGAACATG
CT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan