Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U228279

Score 
177
Direction 
Forward
Predicted Peptide Sequence 
IDTILHNPVLIPVELLKDVYKSYKYQGSYLIDNVLTNXNIWDYHQIRIEEFVYIQKLPVNGXNLKAKESLLDDDWILAMQEEQSVSVNLV
PPQKRTVIGIISNXTASRHDIIVLYAGFSNKSHRKFIKKSFRFLKGTTDLGVWYSIXSNFNLVGHADANYVGYLVDRKSTTSMKHLLGTC
LVQCSTNKQYSFALSSIDVEYMAVDSRSGQLLXIKQQLLNFGMDXGCLPILCDNISVINIAKNPRAT
Predicted Coding Sequence 
ATTGACACTATCTTGCACAATCCAGTGTTGATACCGGTGGAACTTCTCAAGGATGTCTATAAAAGTTACAAGTATCAAGGATCGTATCTA
ATTGACAATGTTCTTACTAATXCTAACATCTGGGATTACCACCAGATTAGGATTGAAGAATTTGTGTACATTCAAAAACTTCCTGTCAAT
GGTXTGAACCTAAAGGCGAAGGAGTCGCTCCTGGATGATGATTGGATACTGGCAATGCAAGAGGAACAATCTGTTAGTGTGAATCTTGTT
CCTCCACAAAAAAGGACAGTGATTGGAATTATATCTAATXTTACTGCAAGTCGACATGATATAATTGTCTTATATGCTGGGTTTTCAAAC
AAATCACATCGAAAATTTATCAAAAAAAGTTTCAGGTTTCTTAAAGGAACAACTGATTTAGGAGTTTGGTACTCCATATGAAGCAATTTC
AACCTTGTAGGGCATGCAGATGCTAATTATGTTGGATATTTGGTGGACAGAAAAAGCACCACAAGTATGAAACACTTACTTGGAACTTGT
CTTGTACAATGTTCCACTAATAAACAATACTCCTTTGCCTTGTCAAGCATTGATGTTGAGTATATGGCAGTTGATTCACGTAGTGGACAA
TTGCTTANGATCAAACAACAACTCTTGAATTTTGGTATGGATNGTGGTTGCCTTCCTATCTTATGTGATAATATTAGTGTCATAAACATT
GCCAAAAATCCXCGTGCAACATAA\
Edits in Original Sequence 
(5')ATTGACACTATCTTGCACAATCCAGTGTTGATACCGGTGGAACTTCTCAAGGAtTGTCTATAAAAGTTACAAGTATCAAGGATCGT
ATCTAATTGACAATGTTCTTACTAATXCTAACATCTGGGATTACCACCAGATTAGGATTGAAGAATTTGTGTACATTCAAAAACTTCCTG
TCAATGGTXTGAACCTAAAGGCGAAGGAGTCGCTCCTGGATGATGATTGGATACTGGCAATGCAAGAGGAACtAATCTGTTAGTGTGAcA
TCTTGTTCCTCCACAAAAAAGGACAGTGATTGGAATTATATCTAATXTTACTGCAAGTCGACATGATATAATTGTCTTATATGCTGGGTT
TTCAAACAAATCACATCGAAAATTTATCAAAAAAAGTTTCAGGTTTCTTAAAGGAACAACTGATTTAGGAGTTTGGTACTCCATATGAAG
CAATTTCAACCTTGTAGGGCATGCAGATGCTAATTATGTTGGATATTTGGTGGACAGAAAAAGCACCACAAGTATGAAACACTTACTTGG
AACTTGTCTTGTACAATGTTCCACTAATAAACAATACTCCTTTGCCTTGTCAAGCATTGATGTTGAGTATATGGCAGTTGATTCACGTAG
TGGACAATTGCTTANGATCAAACAACAACTCTTGAATTTTGGTATGGATNGTGGTTGCCTTCCTATCTTATGTGATAATATTAGTGTCAT
AAACATTGCCAAAAATCCXCGTGCAACATAA\(3')TAAGACTAAACATATTAATATTANGAATCTTTTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan