ESTScan Details for Unigene SGN-U228360

Score 
335
Direction 
Forward
Predicted Peptide Sequence 
RSDFSVAQFPGDFSTGISPFPVFDXAIVEGCFAFGDXVGNECSVMKKVKRKLGKYEVGRTIGEGTFAKVKFARNTETGENVAIKVLAKST
ILKHRMVEQIKREISIMKIVRHPCIVRLHEVLASQTKIYIVQEFVTGGELFDKIVH
Predicted Coding Sequence 
XATCGATCAGATTTCTCCGTTGCTCAATTTCCCGGCGACTTCTCCACCGGAATTTCTCCATTTCCGGTTTTTGATGXAGCTATAGTTGAA
GGTTGCTTTGCTTTTGGTGATXCTGTGGGAAATGAGTGTTCAGTGATGAAGAAAGTGAAGAGAAAGCTTGGGAAGTATGAAGTTGGCAGA
ACTATTGGTGAAGGGACATTTGCCAAGGTTAAGTTTGCACGAAACACCGAGACTGGAGAGAATGTTGCCATTAAAGTCTTGGCCAAAAGT
ACCATTCTTAAGCATAGAATGGTTGAACAGATCAAAAGAGAGATATCTATAATGAAGATTGTCAGACATCCTTGCATAGTTCGACTTCAT
GAGGTTTTAGCTAGCCAGACAAAAATATATATCGTTCAGGAGTTTGTCACTGGAGGAGAGCTTTTTGATAAAATTGTTCAT\
Edits in Original Sequence 
(5')XATCGATCAGATTTCTCCGTTGCTCAATTTCCCGGCGACTTCTCCACCGGAATTTCTCCATTTCCGGTTTTTGATGXAGCTATAGT
TGAAGGTTGCTTTGCTTTTGGTGATXCTGTGGGAAATGAGTGTTCAGTGATGAAGAAAGTGAAGAGAAAGCTTGGGAAGTATGAAGTTGG
CAGAACTATTGGTGAAGGGACATTTGCCAAGGTTAAGTTTGCACGAAACACCGAGACTGGAGAGAATGTTGCCATTAAAGTCTTGGCCAA
AAGTACCATTCTTAAGCATAGAATGGTTGAACAGATCAAAAGAGAGATATCTATAATGAAGATTGTCAGACATCCTTGCATAGTTCGACT
TCATGAGGTTTTAGCTAGCCAGACAAAAATATATATCGTTCAGGAGTTTGTCACTGGAGGAGAGCTTTTTGATAAAATTGTTCAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan