ESTScan Details for Unigene SGN-U228375

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
EDIYRDSIILERESQCRTVFRTAFAPNPDHNSYPDLIVAAISDGSIAAYSISSCLGLNSAGNSLVPVAEPSWLVQGHDGPAYDVKFYGNH
EDSLLLSCGDDGGFEDGSGKKCWDLXESAQGGVSKPVLDLVNPQKKGPWGALSPIPENNCVAVNTQTGSIFAASGDSCAYCWDVETNEIK
MVLKGHSDYLHCIVARNSHNQVITGSEDGTARIWDCRTGKCIQIIDPQKDKKLKELYPYVSCIALDASESWLACGSGQSLSVWNLPACEC
VSGITTSAATQDVX
Predicted Coding Sequence 
XAAGAAGACATATACAGAGATTCCATTATACTCGAGAGAGAATCTCAATGTCGAACGGTCTTCCGGACTGCATTTGCCCCGAACCCGGAC
CATAATTCCTATCCGGACCTCATCGTCGCCGCCATTAGCGACGGCTCCATTGCGGCTTACTCTATCTCTTCTTGCCTTGGATTGAACTCA
GCGGGCAATTCATTGGTGCCAGTAGCTGAACCTAGTTGGCTGGTACAAGGACATGATGGACCTGCTTATGATGTTAAATTTTATGGTAAC
CATGAAGATTCACTATTATTGAGTTGTGGTGATGATGGTGGATTCGAGGATGGAAGTGGAAAGAAATGTTGGGATCTACXGGAATCAGCA
CAAGGAGGCGTATCAAAGCCGGTACTTGACTTGGTAAATCCTCAGAAGAAAGGTCCATGGGGGGCGCTTTCTCCAATACCTGAAAATAAT
TGCGTGGCTGTTAATACTCAGACCGGATCCATATTTGCTGCTTCTGGTGATTCTTGTGCATATTGCTGGGATGTGGAGACGAATGAAATA
AAGATGGTTCTTAAAGGACATTCGGACTACTTGCACTGCATTGTTGCGCGAAATTCTCACAATCAGGTCATAACTGGTTCAGAGGATGGG
ACAGCACGGATATGGGATTGCAGAACTGGTAAATGTATTCAAATAATTGATCCCCAGAAGGATAAGAAGTTAAAGGAGTTGTATCCGTAT
GTCAGTTGCATAGCTCTTGATGCAAGCGAGAGTTGGCTGGCTTGTGGAAGTGGCCAGTCTTTATCTGTTTGGAATCTTCCTGCGTGTGAA
TGTGTTTCAGGTATCACGACAAGTGCTGCTACCCAGGATGTCTXX\
Edits in Original Sequence 
(5')XAAGAAGACATATACAGAGATTCCATTATACTCGAGAGAGAATCTCAATGTCGAACGGTCTTCCGGACTGCATTTGCCCCGAACCC
GGACCATAATTCCTATCCGGACCTCATCGTCGCCGCCATTAGCGACGGCTCCATTGCGGCTTACTCTATCTCTTCTTGCCTTGGATTGAA
CTCAGCGGGCAATTCATTGGTGCCAGTAGCTGAACCTAGTTGGCTGGTACAAGGACATGATGGACCTGCTTATGATGTTAAATTTTATGG
TAACCATGAAGATTCACTATTATTGAGTTGTGGTGATGATGGTcGGATTCGAGGATGGAAGTGGAAAGAAATGTTGGGATCTACXGGAAT
CAGCACAAGGAGGCGTATCAAAGCCGGTACTTGACTTGGTAAATCCTCAGAAGAAAGGTCCATGGGGGGCGCTTTCTCCAATACCTGAAA
ATAATTGCGTGGCTGTTAATACTCAGACCGGATCCATATTTGCTGCTTCTGGTGATTCTTGTGCATATTGCTGGGATGTGGAGACGAATG
AAATAAAGATGGTTCTTAAAGGACATTCGGACTACTTGCACTGCATTGTTGCGCGAAATTCTCACAATCAGGTCATAACTGGTTCAGAGG
ATGGGACAGCACGGATATGGGATTGCAGAACTGGTAAATGTATTCAAATAATTGATCCCCAGAAGGATAAGAAGTTAAAGGAGTTGTATC
CGTATGTCAGTTGCATAGCTCTTGATGCAAGCGAGAGTTGGCTGGCTTGTGGAAGTGGCCAGTCTTTATCTGTTTGGAATCTTCCTGCGT
GTGAATGTGTTTCAGGTATCACGACAAGTGCTGCTACCCAGGATGTCTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan