ESTScan Details for Unigene SGN-U228496

Score 
395
Direction 
Reverse
Predicted Peptide Sequence 
IPSNPYDCIELKYDAALLDAASMAAGFTSPNFSSPSPWQQQILSHLNLDGPNSDLKVTLGGGELVEGRLLAALRVVLSNDEEAVKQHDLE
TLKSLTVEAPLGISTEVSALRTVVALCVIALGHFPTKIMEDKSLLKQNVSPTTELALQFRIQKKSLIVDVMRDLSKXGKVTPCQVVNVLV
XHYPFLIITVVPELAYISSNSTGYLLPPISRXYRVTLFTKACGHHLIDTSTNFGNFGDYGEYGVG
Predicted Coding Sequence 
ATTCCATCAAACCCCTACGACTGCATCGAACTTAAATATGATGCTGCTCTTCTTGATGCTGCCAGTATGGCTGCAGGGTTTACATCCCCA
AACTTCTCCTCGCCATCCCCATGGCAGCAGCAGATTTTATCGCATTTAAATCTAGACGGACCAAACTCTGATCTGAAGGTGACACTAGGA
GGTGGAGAGCTAGTAGAGGGCCGATTATTAGCAGCCTTGAGAGTTGTCCTGTCAAACGATGAAGAAGCAGTGAAGCAGCACGACTTAGAG
ACGCTCAAATCATTGACAGTCGAAGCCCCTCTGGGAATATCAACTGAAGTATCAGCTCTTCGCACCGTTGTGGCTTTGTGTGTTATTGCT
CTCGGACACTTCCCAACGAAAATCATGGAGGACAAGTCGTTGCTGAAGCAAAATGTTTCACCTACTACTGAGTTGGCTCTCCAGTTCAGA
ATACAAAAGAAGTCCCTCATTGTAGATGTTATGAGGGATCTTAGCAAGAXGGGTAAAGTTACTCCTTGCCAAGTAGTTAATGTACTTGTT
GAXCACTATCCTTTTTTAATTATTACTGTGGTGCCCGAGCTAGCTTACATCTCGAGTAACTCTACGGGGTACCTGCTACCTCCCATTAGT
AGAXACTATCGCGTAACTCTATTCACCAAGGCTTGTGGACATCATCTTATTGACACCTCCACAAATTTCGGAAATTTTGGTGATTATGGA
GAGTATGGTGTAGGTTGA\
Edits in Original Sequence 
(5')ATTCCATCAAACCCCTACGACTGCATCGAACTTAAATATGATGCTGCTCTTCTTGATGCTGCCAGTATGGCTGCAGGGTTTACATC
CCCAAACTTCTCCTCGCCATCCCCATGGCAGCAGCAGATTTTATCGCATTTAAATCTAGACGGACCAAACTCTGATCTGAAGGTGACACT
AGGAGGTGGAGAGCTAGTAGAGGGCCGATTATTAGCAGCCTTGAGAGTTGTCCTGTCAAACGATGAAGAAGCAGTGAAGCAGCACGACTT
AGAGACGCTCAAATCATTGACAGTCGAAGCCCCTCTGGGAATATCAACTGAAGTATCAGCTCTTCGCACCGTTGTGGCTTTGTGTGTTAT
TGCTCTCGGACACTTCCCAACGAAAATCATGGAGGACAAGTCGTTGCTGAAGCAAAATGTTTCACCTACTACTGAGTTGGCTCTCCAGTT
CAGAATACAAAAGAAGTCCCTCATTGTAGATGTTATGAGGGATCTTAGCAAGAXGGGTAAAGTTACTCCTTGCCAAGTAGTTAATGTACT
TGTTGAXCACTATCCTTTTTTAATTATTACTGTGGTGCCCGAGCTAGCTTACATCTCGAGTAACTCTACGGGGTACCTGCTACCTCCCAT
TAGTAGAXACTATCGCGTAACTCTATTCACCAAGGCTTGTGGACATCATCTTATTcGACACCTCCACAAATTTCGGAAATTTTGGTGATT
ATGGAGAGTATGGTGTAGGTTGA\(3')ATTCAACTATTTTTCCTTCATCACTTATAGTACACGTGTTTTACGCGAAAAAAAAAAAAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan