ESTScan Details for Unigene SGN-U228586

Score 
169
Direction 
Forward
Predicted Peptide Sequence 
AAQIYXRKIMRGIALALGGSADEMEGEIGGDPFWVFRIIGYPAASISNGHDKAHNDVGCFVHIFSWNQINLSGAHTDYGLLTLVNQDDGI
IALQVRNKSGEWISAPPIPGTFVCNIGDMLKILSNGIYESTLHRVINNSPKYRVCVAYFYEPNFDAAVEPLDVCL
Predicted Coding Sequence 
XXCGCTGCACAGATCTATXCACGAAAGATAATGAGAGGAATTGCTCTGGCATTGGGTGGATCAGCTGATGAAATGGAGGGTGAAATTGGT
GGTGATCCATTTTGGGTCTTTCGAATAATTGGTTACCCTGCTGCGTCCATTTCAAATGGACATGATAAGGCTCACAATGATGTTGGATGT
TTTGTCCATATCTTTTCTTGGAATCAAATAAATCTCAGTGGCGCCCATACAGACTATGGCCTATTGACATTAGTCAACCAGGATGACGGT
ATCATTGCCCTTCAGGTGAGAAATAAATCGGGAGAGTGGATATCAGCACCACCTATCCCCGGCACATTTGTGTGCAATATAGGAGATATG
TTGAAGATCTTATCAAACGGAATTTATGAATCAACATTGCACCGGGTTATCAACAACTCTCCCAAATATCGTGTTTGTGTGGCCTACTTT
TATGAGCCTAACTTCGATGCTGCAGTAGAGCCACTGGATGTGTGTTTA\
Edits in Original Sequence 
(5')XXCGCTGCACAGATCTATXCACGAAAGATAATGAGAGGAATTGCTCTGGCATTGGGTGGATCAGCTGATGAAATGGAGGGTGAAAT
TGGTGGTGATCCATTTTGGGTCTTTCGAATAATTGGTTACCCTGCTGCGTCCATTTCAAATGGACATGATAAGGCTCACAATGATGTTGG
ATGTTTTGTCCATATCTTTTCTTGGAATCAAATAAATCTCAGTGGCGCCCATACAGACTATGGCCTATTGACATTAGTCAACCAGGATGA
CGGTATCATTGCCCTTCAGGTGAGAAATAAATCGGGAGAGTGGATATCAGCACCACCTATCCCCGGCACATTTGTGTGCAATATAGGAGA
TATGTTGAAGATCTTATCAAACGGAATTTATGAATCAACATTGCACCGGGTTATCAACAACTCTCCCAAATATCGTGTTTGTGTGGCCTA
CTTTTATGAGCCTAACTTCGATGCTGCAGTAGAGCCACTGGATGTGTGTTTA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan