ESTScan Details for Unigene SGN-U228667

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
MTTRFSKLLDPKRKNPKKKPGAGTGXDRGWAPWEEILSPEADFARKSLNEGEEVALQSPEAIEAFRMLSPNYRKKKIEEMGITEDEYYAK
QFEIKGDIPEPLETTWAGPWWFDMYPPRI
Predicted Coding Sequence 
ATGACGACGCGTTTCTCGAAGCTTTTGGACCCAAAGAGAAAGAATCCGAAGAAGAAGCCCGGCGCAGGAACTGGGXTCGACCGTGGTTGG
GCTCCATGGGAAGAAATCCTCTCACCTGAAGCTGATTTTGCTCGGAAATCTCTTAATGAAGGTGAAGAAGTTGCGCTTCAGTCACCTGAA
GCTATTGAAGCTTTCAGAATGCTTAGTCCGAACTACCGGAAAAAGAAGATTGAGGAAATGGGTATAACGGAAGATGAGTATTACGCTAAG
CAATTTGAGATTAAAGGAGATATTCCTGAGCCTCTGGAGACTACATGGGCAGGGCCTTGGTGGTTCGACATGTACCCACCTAGGATT\
Edits in Original Sequence 
GCAAACTCTTCAAACTTGTTCTTTCTTCTTCACATTTCCATCTCCTAAAACCCTCCTTAAACCCATAAATTCTTCTAAATTCACTTCTTT
TCCTTTCTTTAATCTCTCTACTTCATCCAATTTCAAGCATTCTCCTCTTACTCTTCACTGTTTCAGTTCAGATGAATACCCAGTAGGTG
(5')ATGACGACGCGTTTCTCGAAGCTTTTGGACCCAAAGAGAAAGAATCCGAAGAAGAAGCCCGGCGCAGGAACTGGGXTCGACCGTGGT
TGGGCTCCATGGGAAGAAATCCTCTCACCTGAAGCTGATTTTGCTCGGAAATCTCTTAATGAAGGTGAAGAAGTTGCGCTTCAGTCACCT
GAAGCTATTGAAGCTTTCAGAATGCTTAGTCCGAACTACCGGAAAAAGAAGATTGAGGAAATGGGTATAACGGAAGATGAGTATTACGCT
AAGCAATTTGAGATTAAAGGAGATATTCCTGAGCCTCTGGAGACTACATGGGCAGGGCCgTTGGTGGTTCGACATGTACCCACCTAGGAT
T\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan