ESTScan Details for Unigene SGN-U228718

Score 
230
Direction 
Forward
Predicted Peptide Sequence 
MVGLSVVLEGCNNKDINTINASSTWQILNKASMVLMKPTSPFSTPKSPEPSGFLDSCFLCKQKLLPGKDIYMYKGEWAFCSVECRCKQIF
MDEEESMKTKSKASIKSCTSSSSSSSSSYRSRKTAARNRPNAFAY
Predicted Coding Sequence 
ATGGTGGGTCTCAGTGTAGTACTCGAAGGTTGCAATAATAAAGATATCAATACAATAAATGCTTCTTCTACTTGGCAAATTCTTAACAAA
GCTAGTATGGTATTGATGAAACCCACTTCTCCTTTTTCCACCCCAAAATCTCCCGAACCTTCTGGGTTTCTCGATTCCTGTTTCCTTTGT
AAACAGAAACTCTTACCTGGAAAAGACATCTACATGTACAAGGGAGAATGGGCATTTTGTAGCGTAGAGTGCAGGTGCAAGCAGATTTTT
ATGGATGAAGAAGAGAGTATGAAAACGAAATCTAAAGCTTCCATTAAATCGTGTACTTCTTCTTCTTCATCATCATCGTCGTCTTACCGG
AGTAGGAAAACGGCGGCGAGGAACCGACCGAATGCGTTTGCATACTGA\
Edits in Original Sequence 
TCCTATTTAGCAACAAAGTTTTTTTTCTTTTTGAGATTAACCAAAATCTCTTTCTCCTCATGAG(5')ATGGTGGGTCTCAGTGTAGTAC
TCGAAGGTTGCAATAATAAAGATATCAATACAATAAATGCTTCTTCTACTTGGCAAATTCTTAACAAAGCTAGTATGGTATTGATGAAAC
CCACTTCTCCTTTTTCCACCCCAAAATCTCCCGAACCTTCTGGGTTTCTCGATTCCTGTTTCCTTTGTAAACAGAAACTCTTACCTGGAA
AAGACATCTACATGTACAAGGGAGAATGGGCATTTTGTAGCGTAGAGTGCAGGTGCAAGCAGATTTTTATGGATGAAGAAGAGAGTATGA
AAACGAAATCTAAAGCTTCCATTAAATCGTGTACTTCTTCTTCTTCATCATCATCGTCGTCTTACCGGAGTAGGAAAACGGCGGCGAGGA
ACCGACCGAATGCGTTTGCATACTGA\(3')GAAAGGAGTTGGGTTGGACGAAAATTTCCAGTTTTGTCCTCGATACATTTTGTAATGAC
TATGGTATCCGTTTTCATTTTGAATTTTGTGAAATTATTAATATTAGTAGTACGGAAAAAAACAAAAAACTGCTGCTAGTTTTCATTTAT
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan