Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U228897

Score 
430
Direction 
Reverse
Predicted Peptide Sequence 
STCLMVALMTCYMTRPKMQFVGDWXTRYKIALGVAQGICYLHHDCDPVIVHRDLKPSNILLDGEMEARVADFGVAKLIECDESMSVIAGS
YGYIAPEYAYTLQVDEKSDIYSYGXGVNGNFIGKKIGDSEFGDGNSIVDWVRSKMKIKNGVTDILDKNIGASCPRVREEMMLMLRVALLC
TSRNPADRPSMRDVVSMLQEAKPKRKLPGSGGDNSIGLVCLAQ
Predicted Coding Sequence 
AGTACATGCCTAATGGTAGCCTTGATGACTTGTTACATGACAAGACCAAAGATGCAATTTGTTGGTGATTGGTTNACTAGGTACAAAATT
GCACTTGGTGTTGCACAAGGGATTTGTTATCTTCATCATGATTGTGACCCTGTCATTGTTCATCGTGACCTAAAACCTAGCAACATTCTT
CTTGATGGTGAAATGGAAGCTAGGGTTGCTGATTTTGGGGTTGCTAAATTGATTGAATGCGACGAATCGATGTCCGTCATTGCTGGATCT
TATGGCTACATTGCACCCGAATACGCGTATACATTGCAAGTGGACGAAAAGAGTGACATTTATAGCTATGGAGXTGGTGTTAATGGAAAT
TTTATCGGGAAAAAGATCGGAGATTCGGAATTTGGCGATGGAAATAGCATTGTGGATTGGGTGAGGTCCAAGATGAAGATTAAAAACGGT
GTAACTGATATTTTGGATAAAAATATCGGTGCTTCGTGTCCTCGAGTGAGGGAGGAAATGATGTTGATGCTTAGGGTGGCGTTGCTATGT
ACTAGCCGGAACCCGGCTGACCGGCCTTCGATGAGGGATGTTGTGTCCATGTTACAAGAGGCCAAGCCCAAGAGGAAGTTGCCCGGAAGT
GGTGGTGACAATTCAATTGGTCTTGTTTGTTTGGCCCAATAG\
Edits in Original Sequence 
(5')AGTACATGCCTAATGGTAGCCTTGATGACTTGTTACATGACAAGACCAAAGATGCAATTTGTTgGGTGATTGGTTNACTAGGTACA
AAATTGCACTTGGTGTTGCACAAGGGATTTGTTATCTTCATCATGATTGTGACCCTGTCATTGTTCATCGTGACCTAAAACCTAGCAACA
TTCTTCTTGATGGTGAAATGGAAGCTAGGGTTGCTGATTTTGGGGTTGCTAAATTGATTGAATGCGACGAATCGATGTCCGTCATTGCTG
GATCTTATGGCTACATTGCACCCGAATACGCGTATACATTGCAAGTGGACGAAAAGAGTGACATTTATAGCTATGGAGXTGGTGTTAATG
GAAATTTTATCGGGAAAAAGATCGGtAGATTCGGAATTTGGCGATGGAAATAGCATTGTGGATTGGGTGAGGTCCAAGATGAAGATTAAA
AACGGTGTAACTGATATTTTGGATAAAAATATCGGTGCTTCGTGTCCTCGAGTGAGGGAGGAAATGATGTTGATGCTTAGGGTGGCGTTG
CTATGTACTAGCCGGAACCCGGCTGACCGGCCTTCGATGAGGGATGTTGTGTCCATGTTACAAGAGGCCAAGCCCAAGAGGAAGTTGCCC
GGAAGTGGTGGTGACAATTCAATTGGTCTTGTTTGTTTGGCCCAATAG\(3')GCCAATGTGGAGTGTTACTATAATTGGAGATTCGGGG
TTTTTTCTTCTTCTTTTCAATTGTGGGGGATTGGTATAATCGTATAGGACAAGTACGCAATGTTTTCTTTTAAAACTTTTAACTAGTGAA
ATTTCAGATATTTTGATTTCTGAGTGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan