ESTScan Details for Unigene SGN-U228913

Score 
38
Direction 
Forward
Predicted Peptide Sequence 
CYSDIPNAXKQIEPIILLELYQVDYKGMDTFEKDEMPMLSPSYPQSDGNDAFQNRRSTYRTRSASLSMPMSSIDSFENDSSYVGYTGPLR
SERRTSLVQMSGPLYIGREPENSFRPTPAAVVHKSTLPPTERYPSISSAERNGWRNNDYTGKNEHLFKSGQLGMCNDPYCTTCPTYYHLK
ARQN
Predicted Coding Sequence 
XTTTGCTACTCTGATATTCCTAATGCCXGGAAGCAGATTGAACCCATAATTCTTCTGGAGTTGTATCAGGTTGACTATAAAGGGATGGAC
ACCTTTGAAAAAGATGAGATGCCGATGTTATCACCATCATATCCACAGTCTGATGGAAATGACGCCTTTCAAAATCGACGTTCTACGTAC
AGGACAAGGAGTGCATCCCTGTCAATGCCAATGAGCTCTATAGATTCATTTGAAAATGATAGTAGTTATGTAGGCTATACTGGTCCTTTG
AGAAGTGAGAGGCGAACTTCATTGGTTCAAATGAGTGGGCCATTATATATTGGTCGCGAGCCTGAGAATAGCTTTCGGCCCACTCCCGCT
GCAGTAGTGCATAAATCAACTCTGCCTCCAACAGAAAGATATCCTTCAATTAGCAGTGCAGAACGAAATGGTTGGCGTAATAATGACTAC
ACTGGGAAAAATGAACATCTCTTTAAGTCTGGACAACTGGGCATGTGCAACGATCCGTACTGCACAACATGTCCAACCTATTACCATTTA
AAAGCACGGCAAAAT\
Edits in Original Sequence 
(5')XTTTGCTACTCTGATATTCCTAATGCCXGGAAGCAGATTGAACCCATAATTCTTCTGGAGTTGTATCAGGTTGACTATAtAAGGGA
TGGACACCTTTGAAAAAGATGAGATGCCGATGTTATCACCATCATATCCACAGTCTGATGGAAATGACGCCTTTCAAAATCGACGTTCTA
CGTACAGGACAAGGAGTGCATCCCTGTCAATGCCAATGAGCTCTATAGATTCATTTGAAAATGATAGTAGTTATGTAGGCTATACTGGTC
CTTTGAGAAGTGAGAGGCGAACTTCATTGGTTCAAATGAGTGGGCCATTATATATTGGTCGCGAGCCTGAGAATAGCTTTCGGCCCACTC
CCGCTGCAGTAGTGCATAAATCAACTCTGCCTCCAACAGAAAGATATCCTTCAATTAGCAGTGCAGAACGAAATGGTTGGCGTAATAATG
ACTACACTGGGAAAAATGAACATCTCTTTAAGTCTGGACAACTGGGCATGTGCAACGATCCGTACTGCACAACATGTCCAACCTATTACC
ATTTAAAAGCACGGCAAAAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan