ESTScan Details for Unigene SGN-U228920

Score 
495
Direction 
Forward
Predicted Peptide Sequence 
ESLKENTGMESSVAAENDSNPPEDDVKERCWDQREALPGEPRCIVCGRYGEYICDETDDDXLQLGMQGYIVVAVGESRQPTARPCPVKLP
ATDECYYVRDNGKSEVNPLTTEQTELLRRKLDILVKGDTTPPPILSFASCKLPQKLLENIEVADYEMPTPVQMQAIPAALARRSLLVSAE
TGSGKTGSFXIPIVSQCAKINEEHX
Predicted Coding Sequence 
GAATCATTGAAGGAGAATACTGGAATGGAAAGTTCTGTAGCTGCAGAAAATGATAGTAATCCCCCAGAGGATGATGTGAAGGAGAGGTGT
TGGGACCAAAGAGAAGCGCTGCCGGGTGAGCCTCGATGTATCGTATGTGGCCGCTATGGTGAGTACATTTGTGATGAGACTGATGATGAT
XATTTGCAGCTTGGAATGCAAGGGTATATTGTTGTCGCGGTTGGAGAATCACGGCAACCTACTGCTCGTCCATGCCCTGTGAAGTTACCA
GCAACTGATGAGTGCTATTATGTAAGGGATAATGGTAAGTCTGAAGTGAATCCGCTAACAACTGAGCAGACTGAACTTCTGAGAAGGAAA
CTTGATATTCTTGTGAAGGGAGATACTACACCGCCTCCCATCTTGTCATTTGCTTCTTGCAAGCTACCTCAGAAGCTTCTCGAGAATATT
GAAGTTGCTGATTATGAAATGCCAACTCCTGTTCAAATGCAAGCAATCCCTGCTGCTTTAGCACGGCGAAGCTTGCTTGTTTCAGCGGAG
ACTGGTTCTGGTAAAACTGGCTCTTTTXCTATTCCTATAGTTTCTCAGTGCGCGAAAATCAATGAAGAGCATTXX\
Edits in Original Sequence 
(5')GAATCATTGAAGGAGAATACTGGAATGGAAAGTTCTGTAGCTGCAGAAAATGATAGTAATCCCCCAGAGGATGATGTGAAGGAGAG
GTGTTGGGACCAAAGAGAAGCGCTGCCGGGTGAGCCTCGATGTATCGTATGTGGCCGCTATGGTGAGTACATTTGTGATGAGACTGATGA
TGATXATTTGCAGCTTGGAATGCAAGGGTATATTGTTGTCGCGGcTTGGAGAATCACGGCAACCTACTGCTCGTCCATGCCCTGTGAAGT
TACCAGCAACTGATGAGTGCTATTATGTAAGGGATAATGGTAAGTCTGAAGTGAATCCGCTAACAACTGAGCAGACTGAACTTCTGAGAA
GGAAACTTGATATTCTTGTGAAGGGAGATACTACACCGCCTCCCATCTTGTCATTTGCTTCTTGCAAGCTACCTCAGAAGCTTCTCGAGA
ATATTGAAGTTGCTGATTATGAAATGCCAACTCCTGTTCAAATGCAAGCAATCCCTGCTGCTTTAGCACGGCGAAGCTTGCTTGTTTCAG
CGGAGACTGGTTCTGGTAAAACTGGCTCTTTTXCTATTCCTATAGTTTCTCAGTGCGCGAAAATCAATGAAGAGCATTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan