ESTScan Details for Unigene SGN-U228982

Score 
237
Direction 
Forward
Predicted Peptide Sequence 
MLCPNCYSGHIIVDCTCIMHKLLKSSQNLTSGGARIFTEVQIMKKKHTKKPNECYYDTSQVTDELVQAILLPGLEPGAVDVFLEFICYSA
GPLPEELLPQVKCPVLVAWGDKDPWEPIELGRAYGNFDTVEDFVVLPNVGHCPQDEAPHLXEPTGGIICCPACQRMRAESR
Predicted Coding Sequence 
ATGTTGTGCCCCAATTGCTATTCTGGACATATAATTGTGGATTGCACATGCATTATGCATAAGCTATTGAAAAGTTCACAGAATCTGACC
AGTGGCGGAGCTAGGATTTTCACXGAGGTTCAAATCATGAAGAAGAAACACACCAAGAAGCCAAATGAGTGCTACTACGACACATCCCAG
GTGACGGATGAGTTAGTACAGGCAATCCTTCTTCCAGGGCTTGAACCTGGTGCTGTCGATGTGTTTCTCGAGTTCATTTGCTATTCAGCG
GGGCCTCTACCCGAGGAACTACTACCTCAAGTGAAGTGTCCTGTTCTGGTGGCATGGGGTGACAAGGATCCTTGGGAGCCAATAGAACTT
GGTAGAGCCTATGGCAACTTTGATACAGTCGAAGATTTTGTCGTCCTCCCTAATGTTGGCCATTGTCCTCAGGACGAGGCACCTCATCTT
GXTGAACCCACTGGTGGAATCATTTGTTGCCCGGCATGCCAACGTATGAGAGCTGAGTCGCGGTGA\
Edits in Original Sequence 
AACAACACTTAGGACCCCCGTGTCTGTAAACTTATTTTTGCCGAAGAAATTCAATGCTTGACTGTAAAAA(5')ATGTTGTGCCCCAATT
GCTATTCTGGACATATAATTGTGGATTGCACATGCATTATGCATAAGCTATTGAAAAGTTCACAGAATCTGACCAGTGGCGGAGCTAGGA
TTTTCACXGAGGTTCAAATCATGAAGAAGtAAACACACCAAGAAGCCAAATGAGTGCTACTACGACACATCCCAGGTGACGGATGAGTTA
GTACAGGCAATCCTTCTTCCAGGGCTTGAACCTGGTGCTGTCGATGTGTTTCTCGAGTTCATTTGCTATTCAGCGGGGCCTCTACCCGAG
GAACTACTACCTCAAGTGAAGTGTCCTGTTCTGGTGGCATGGGGTGACAAGGATCCTTGGGAGCCAATAGAACTTGGTAGAGCCTATGGC
AACTTTGATACAGTCGAAGATTTTGTCGTCCTCCCTAATGTTGGCCATTGTCCTCAGGACGAGGCACCTCATCTTGXTGAACCCACTGGT
GGAATCATTTGTTGCCCGGCATGCCAACGTATGAGAGCTGAGTCGCGGTGA\(3')GCGTGTAGTCTTATTGTTTACATCAGAATACACG
TATGGTTTCGCGTCGCTAGTCGAAAAAGACAGAAGAATGTACATGGGAGAACAAGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan