Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U229056

Score 
261
Direction 
Forward
Predicted Peptide Sequence 
STTTSGSCYQAPEALKVVKPSQKWDIYSYGVILLEMITGRTPIIQVGSTEMDLETGFTGAXEEKKPLSDVLDSCLAQDADKEEEMIAVLK
IAMACVHSSPERRPSMRHISDALADCKLPLNEXIETEPSGWLHIAARITASNR
Predicted Coding Sequence 
TCAACTACAACATCTGGTTCTTGCTACCAAGCTCCCGAGGCGTTAAAAGTGGTGAAACCATCACAAAAATGGGACATTTACTCGTACGGA
GTGATCTTGCTTGAAATGATCACGGGAAGAACCCCGATTATCCAAGTAGGTTCTACTGAAATGGATCTCGAAACTGGATTCACTGGTGCA
XTTGAAGAGAAGAAGCCACTTTCGGATGTATTGGACTCGTGTTTAGCACAAGATGCTGATAAAGAAGAGGAAATGATCGCGGTTTTGAAG
ATTGCAATGGCGTGTGTTCACAGCAGCCCGGAGAGAAGACCTTCAATGAGACACATATCTGATGCATTAGCAGACTGCAAGCTTCCTCTG
AATGAAXCAATTGAAACAGAACCTTCAGGCTGGCTTCACATTGCTGCAAGGATTACAGCATCTAACCGATAA\
Edits in Original Sequence 
(5')TCAACTACAACATCTGGTTCTTGCTACCAAGCTCCCGAGGCGTTAAAAGTGGTGAAACCATCACAAAAATGGGACATTTACTCGTA
CGGAGTGATCTTGCTTGAAATGATCACGGGAAGAACCCCGATTATCCAAGTAGGTTCTACTGAAATGGATCTCGtAAACTGGATTCACTG
GTGCAXTTGAAGAGAAGAAGCCACTTTCGGATGTATTGGACTCGTGTTTAGCACAAGATGCTGATAAAGAAGAGGAAATGATCGCGGTTT
TGAAGATTGCAATGGCGTGTGTTCACAGCAGCCCGGAGAGAAGACCTTCAATGAGACACATATCTGATGCATTAGaCAGACTGCAAGCTT
CCTCTGAATGAAXCAATTGAAACAGAACCTTCAGGCTGGCTTCACATTGCTGCAAGGATTACAGCATCTAACCGATAA\(3')CCATGAA
GCACGATCACTGCTTGGTGCGCGATACATATTGACTAACAGTAGTAATCTCCACTTGTTTGTGAAGGAATATCTGTTTGAATATTGGCCT
TTTTGCTCTCTGATAGCAAGCTTTTTCTTGTGTCTATTTGATTAAGAACATAAATTATTTGTTTCTCTCCTTATTACTACATTACTATTC
ATCTTTTGTTTGTCACAAATGAGTATATGTAAATAAAAATGATTTGTCAAAAATATTAAATAAGATGGTGTAAGCAATAACTGTAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan