ESTScan Details for Unigene SGN-U229211

Score 
515
Direction 
Forward
Predicted Peptide Sequence 
MAAHIGMMDGAYFVGRSEILAWINSTLHLNLSKVEEACTGAVHCQLMDAAHPGLVPMHKVNFDAKNEYEMIQNYKVLQDVFTKLKITKHI
EVSKLVKGRPLDNLEFMQWLKRYCDSVNGGNLHSYNPLERREGCKGAKEVNKRSAPSQNATKNASTASKHVSHNTRRNEVPHVSSTNQSG
KSRSLLQVEGSSTYSETERTAHX
Predicted Coding Sequence 
ATGGCGGCACACATAGGAATGATGGATGGGGCATACTTCGTCGGTAGATCGGAAATCCTGGCTTGGATCAATTCCACACTTCATCTAAAT
CTTTCCAAAGTCGAAGAGGCGTGTACTGGTGCAGTTCATTGCCAGTTAATGGATGCCGCTCACCCAGGGCTAGTCCCTATGCACAAGGTC
AATTTTGATGCCAAGAACGAGTATGAGATGATCCAAAACTATAAGGTTCTTCAGGATGTATTCACTAAACTCAAGATTACCAAGCACATT
GAGGTTAGCAAATTGGTGAAAGGAAGACCTCTTGACAACCTGGAGTTTATGCAATGGTTGAAGAGATACTGCGATTCTGTTAATGGGGGC
AATCTTCACAGTTACAATCCTCTTGAAAGAAGGGAGGGGTGCAAGGGTGCCAAAGAAGTGAACAAAAGATCTGCTCCTTCACAAAATGCT
ACCAAAAATGCCTCGACTGCTTCAAAGCATGTCTCCCATAACACTAGAAGAAATGAAGTACCTCATGTAAGCAGCACAAATCAATCTGGT
AAATCTCGNAGCCTTCTTCAAGTGGAGGGATCGTCAACCTATTCTGAAACTGAACGTACTGCACATGAX\
Edits in Original Sequence 
TCTCCCCTCTTTGTTTCTCTCACTACGGAGCCTTCTAGAGATCTTCTCCGTCGAGGAAAAAAGTGAAGGAGAA(5')ATGGCGGCACACA
TAGGAATGATGGATGGGGCATACTTCGTCGGTAGATCGGAAATCCTGGCTTGGATCAATTCCACACTTCATCTAAATCTTTCCAAAGTCG
AAGAGGCGTGTACTGGTGCAGTTCATTGCCAGTTAATGGATGCCGCTCACCCAGGGCTAGTCCCTATGCACAAGGTCAATTTTGATGCCA
AGAACGAGTATGAGATGATCCAAAACTATAAGGTTCTTCAGGATGTATTCACTAAACTCAAGATTACCAAGCACATTGAGGTTAGCAAAT
TGGTGAAAGGAAGACCTCTTGACAACCTGGAGTTTATGCAATGGTTGAAGAGATACTGCGATTCTGTTAATGGGGGCAATCTTCACAGTT
ACAATCCTCTTGAAAGAAGGGAGGGGTGCAAGGGTGCCAAAGAAGTGAACAAAAGATCTGCTCCTTCACAAAATGCTACCAAAAATGCCT
CGACTGCTTCAAAGCATGTCTCCCATAACACTAGAAGAAATGAAGTACCTCATGTAAGCAGCACAAATCAATCTGGTAAgATCTCGNAGC
CTTCTTCAAGTGGAGGGATCGTCAACCTATTCTGAAACTGAACGTACTGCACATGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan