ESTScan Details for Unigene SGN-U229257

Score 
556
Direction 
Reverse
Predicted Peptide Sequence 
EKQNMQFSSECKGGFFADQFENLANFRSHYEGTGPEIWEQTGGNLDAFIAAAGTGGTVAGVSQYLKDKNSNIKCFLIDPPGSGLYNKVTR
GVMYTREEAEGRRLKNPFDTITEGIGINRLTENFKMAKLDGAFRGTDMEAVEMSRYLLKNDGLFIGSSSAMNCVGAVRVAKALGPGHTIV
TILCDSGMRHLSKFHNDKYLSEHGLTPSATGLEFLRLVDLMASSRLFFGAFKFMTVPSQS
Predicted Coding Sequence 
GAAAAGCAGAATATGCAGTTCTCATCTGAATGCAAGGGTGGATTCTTCGCAGATCAGTTTGAAAATCTTGCAAATTTCAGGTCACATTAT
GAGGGCACGGGGCCAGAGATTTGGGAACAGACAGGTGGCAATTTGGATGCTTTTATTGCTGCTGCAGGTACAGGTGGCACTGTTGCCGGT
GTTTCCCAGTATTTGAAGGACAAAAACTCAAATATCAAGTGCTTCCTTATTGATCCTCCTGGCTCTGGTTTATATAACAAAGTAACAAGG
GGAGTTATGTACACAAGGGAAGAAGCCGAAGGAAGAAGGCTGAAGAACCCGTTTGATACAATAACCGAAGGGATTGGAATAAATAGACTA
ACTGAAAATTTTAAGATGGCAAAACTTGATGGAGCTTTCCGAGGCACAGATATGGAAGCTGTTGAAATGTCCAGGTATCTGTTGAAAAAT
GATGGTCTATTTATTGGAAGTTCTTCAGCGATGAATTGCGTTGGAGCTGTCAGAGTGGCAAAGGCACTAGGTCCAGGGCATACAATTGTG
ACAATCTTGTGTGACAGTGGTATGAGACACTTGAGTAAGTTTCACAATGATAAATACCTATCTGAACATGGGTTGACACCTTCAGCAACT
GGTCTGGAGTTCCTTCGTCTTGTTGATCTXATGGCTAGTTCACGATTGTTTTTCGGGGCATTTAAATTCATGACAGTACCATCTCAGAGC
TAA\
Edits in Original Sequence 
(5')GAAAAGCAGAATATGCAGTTCTCATCTGAATGCAAGGGTGGATTCTTCGCAGATCAGTTTGAAAATCTTGCAAATTTCAGGTCACA
TTATGAGGGCACGGGGCCAGAGATTTGGGAACAGACAGGTGGCAATTTGGATGCTTTTATTGCTGCTGCAGGTACAGGTGGCACTGTTGC
CGGTGTTTCCCAGTATTTGAAGGACAAAAACTCAAATATCAAGTGCTTCCTTATTGATCCTCCTGGCTCTGGTTTATATAACAAAGTAAC
AAGGGGAGTTATGTACACAAGGGAAGAAGCCGAAGGAAGAAGGCTGAAGAACCCGTTTGATACAATAACCGAAGGGATTGGAATAAATAG
ACTAACTGAAAATTTTAAGATGGCAAAACTTGATGGAGCTTTCCGAGGCACAGATATGGAAGCTGTTGAAATGTCCAGGTATCTGTTGAA
AAATGATGGTCTATTTATTGGAAGTTCTTCAGCGATGAATTGCGTTGGAGCTGTCAGAGTGGCAAAGGCACTAGGTCCAGGGCATACAAT
TGTGACAATCTTGTGTGACAGTGGTATGAGACACTTGAGTAAGTTTCACAATGATAAATACCTATCTGAACATGGGTTGACACCTTCAGC
AACTGGTCTGGAGTTCCTTCGTCTTaGTTGATCTXATGGCTAGTTCACGATTGTTTTTCGGGGCATTTAAATTCATGACAGTACCATCTC
AGAGCTAA\(3')TATTGTATATACTATGGTAGGAAAAGGAAGTTTTGATAATTTTTTATAAGTTTAACATCGTTTGTGTATGTCAGCTT
GATAGAGAATATTAGAGGCAGGCTCTAATTGTTTTGATCTAATTTTGTAATGTTTAACTTTCTTATTTGATAAAAACCTATCTCAATCAA
GAGCTTTTATAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan