ESTScan Details for Unigene SGN-U229310

Score 
100
Direction 
Forward
Predicted Peptide Sequence 
MSSFSSNFKLLLSYTKLLTSHVNQGKHEQALSLXSPNPFNSLSFTRPLRVPSRPQILRRAEFLSARATIHAHTIKASFGSNPFVACALVD
MYGKCVSVEYARQLFDESPERNVVVWNSMISVYAHCDEVGRALELFRVMDVEPNSSTFNAII
Predicted Coding Sequence 
ATGAGTTCTTTTTCTTCAAACTTCAAACTTTTGCTTTCTTACACAAAACTCTTAACATCTCATGTCAATCAAGGCAAACATGAACAAGCT
CTTTCTCTTXTTTCACCAAATCCATTCAACTCTCTCTCGTTCACTCGACCCCTTCGTGTTCCCTCTCGCCCTCAAATCTTGCGCCGCGCT
GAGTTTCTCTCAGCTCGGGCAACCATTCACGCACACACAATCAAAGCCTCTTTCGGTTCCAACCCCTTTGTTGCTTGTGCATTAGTAGAC
ATGTATGGGAAATGTGTCTCTGTAGAGTACGCACGCCAACTGTTTGATGAATCTCCGGAGAGAAATGTAGTGGTTTGGAACTCGATGATC
TCGGTTTACGCGCATTGTGATGAGGTTGGGAGGGCGTTGGAGTTGTTTCGAGTGATGGATGTGGAGCCTAATTCTTCTACTTTTAACGCG
ATTATC\
Edits in Original Sequence 
TGAGTTCTGAAACAACATATGTATTCTCTATCAATACCCCTCACAACTCTGGTTCCACATCAGATAACTGCGTTTGCTTAAAACAAAATA
AATTAAGGGACTTTGTTTTATTGGGTATATATATATATTCAAAACAAGGCGGCAAAAAGCACAAGGCA
(5')ATGAGTTCTTTTTCTTCA
AACTTCAAACTTTTGCTTTCTTACACAAAACTCTTAACATCTCATGTCAATCAAGGCAAACATGAACAAGCTCTTTCTCTTXTTTCACCA
AATCCATTCAACTCTCTCTCGTTCACTCGACCCCTTCGTGTTCCCTCTCGCCCTCAAATCTTGCGCCGCGCTGAGTTTCTCTCAGCTCGG
cGCAACCATTCACGCACACACAATCAAAGCCTCTTTCGGTTCCAACCCCTTTGTTGCTTGTGCATTAGTAGACATGTATGGGAAATGTGT
CTCTGTAGAGTACGCACGCCAACTGTTTGATGAATCTCCGGAGAGAAATGTAGTGGTTTGGAACTCGATGATCTCGGTTTACGCGCATTG
TGATGAGGTTGGGAGGGCGTTGGAGTTGTTTCGAGTGATGGATGTGGAGCCTAATTCTTCTACTTTTAACGCGATTATC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan