ESTScan Details for Unigene SGN-U229396

Score 
454
Direction 
Forward
Predicted Peptide Sequence 
MGNTGSNGXEWPEKKLQPPAEPPPQPEITGNSYVFAAASPPYSYQQNPNTTPYYQYPGYYPPPYEQHSHHHMNPNYANWVNGGYPCEPPM
IPPTPAPYVEHQKAVTIRNDVNLKKETLRIEADEANPGKYLVAFDFDATVAGSLTVIFFAKEGEDCCLTPMXESLLPPITIQFQKGLSQK
FRQSSGTGIDVSMFGEAELCNADIYQLAVKAEALEDGNVST
Predicted Coding Sequence 
ATGGGTAATACCGGAAGTAATGGTXATGAATGGCCGGAGAAGAAATTACAGCCACCGGCGGAGCCACCTCCACAACCGGAGATCACCGGT
AACAGTTACGTATTTGCCGCAGCATCGCCACCATATTCTTATCAGCAAAATCCTAATACGACACCGTATTATCAGTACCCGGGTTATTAT
CCGCCGCCGTATGAACAGCATTCCCACCACCATATGAACCCTAATTATGCAAATTGGGTTAATGGCGGTTACCCGTGTGAACCACCCATG
ATACCTCCAACGCCTGCACCTTATGTGGAGCATCAAAAAGCTGTGACGATACGTAATGATGTGAATCTGAAGAAGGAGACTCTAAGGATT
GAGGCGGATGAAGCTAATCCTGGAAAATACCTCGTCGCTTTCGATTTCGACGCCACCGTAGCTGGAAGCTTGACTGTCATTTTCTTTGCA
AAAGAAGGTGAAGATTGTTGCTTGACTCCTATGAANGAAAGTTTACTTCCACCAATAACCATTCAATTTCAAAAAGGTTTATCTCAGAAA
TTTAGGCAATCCTCTGGAACTGGCATTGATGTTTCCATGTTTGGAGAGGCAGAATTGTGTAATGCAGATATATATCAGCTGGCGGTGAAG
GCAGAAGCATTGGAGGATGGAAATGTGTCCACX\
Edits in Original Sequence 
TTTAATTTGGGAGATAAATTTTGATTTTGGGTAAAAGGGTAGAAATTATTTAG(5')ATGGGTAATACCGGAAGTAATGGTXATGAATGG
CCGGAGAAGAAATTACAGCCACCGGCGGAGCCACCTgCCACAACCGGAGATCACCGGTAACAGTTACGTATTTGCCGCAGCATCGCCACC
ATATTCTTATCAGCAAAATCCTAATACGACACCGTATTATCAGTACCCGGGTTATTATCCGCCGCCGTATGAACAGCATTCCCACCACCA
TATGAACCCTAATTATGCAAATTGGGTTAATGGCGGTTACCCGTGTGAACCACCCATGATACCTCCAACGCCTGCACCTTATGTGGAGCA
TCAAAAAGCTGTGACGATACGTAATGATGTGAATCTGAAGAAGGAGACTCTAAGGATTGAGGCGGATGAAGCTAATCCTGGAAAATACCT
CGTCGCTTTCGATTTCGACGCCACCGTAGCTGGAAGCTTGACTGTCATTTTCTTTGCAAAAGAAGGTGAAGATTGTTGCTTGACTCCTAT
GAANGAAAGTTTACTTCCACCAATAACCATTCAATTTCAAAAAGGTTTATCTCAGAAATTTAGGCAATCCTCTGGAACTGGCATTGATGT
TTCCATGTTTGGAGAGGCAGAATTGTGTAATGCAGATATATATCAGCTGGCGGTGAAGGCAGAAGCATTGGAGGATGGAAATGTGTCCAC
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan