ESTScan Details for Unigene SGN-U229456

Score 
239
Direction 
Forward
Predicted Peptide Sequence 
MVPFFTTVYYKKLGSPTSVKFGWTQHNVLFLPNPHHIRFQPLADNTSKFRLDDXPLGLRDFSNISAXSQRLLLTGGPKGIFPCYQLAADA
SVQAMLIATNAAFPKIPPTSSNLRDFLKKSKLQKNILNRAFDLFFICVVKFSPVALVAGPYRFSGETNX
Predicted Coding Sequence 
ATGGTTCCCTTCTTTACTACCGTCTACTATAAGAAACTTGGTTCTCCCACCTCAGTAAAATTTGGCTGGACACAACATAATGTCCTCTTT
CTCCCCAATCCTCACCATATTCGGTTTCAGCCCCTGGCTGACAACACATCCAAATTTAGGCTGGATGATGAXCCCCTCGGGCTGAGAGAT
TTTTCTAATATTTCTGCTGXTAGTCAACGTCTTCTCCTAACGGGAGGTCCAAAAGGTATTTTTCCTTGCTACCAACTTGCTGCAGATGCA
TCAGTGCAAGCXATGCTGATTGCAACCAACGCTGCATTCCCCAAAATTCCACCCACTTCATCCAATCTAAGAGACTTCCTAAAGAAATCA
AAACTACAAAAGAATATATTGAATAGAGCATTTGATCTCTTCTTTATCTGCGTCGTTAAATTTTCACCTGTGGCGCTTGTAGCAGGACCA
TACAGATTTTCAGGAGAAACAAACTGX\
Edits in Original Sequence 
TTTTTCATCGGCAACAGGTAATCAAATTTTTTTGAACTTCACACTGACACATGCACATAGACTATAGTATAAAATCTGTCACATGTTCCA
AAGAAAGGGAGATGTAGCTCTTTACAACATTTATAGATAGCAAAAAT
(5')ATGGTTCCCTTCTTTACTACCGTCTACTATAAGAAACTT
GGTTCTCCCACCTCAGTAAAATTTGGCTGGACACAACATAATGTCCTCTTTCTCCCCAATCCTCACCATATTCGGTTTCAGCCCCTGGCT
GACAACACATCCAAATTTAGGCTGGATGATGAXCCCCTCGGGCTGAGAGATTTTTCTAATATTTCTGCTGXTAGTCAACGTCTTCTCCTA
ACGGGAGGTCCAAAAGGTATTTTTCCTTGCTACCAACTTGCTGCAGATGCATCAGTGCAAGCXATGCTGATTGCAACCAACGCTGCATTC
CCCAAAATTCCACCCACTTCATCCAATCTAAGAGACTTCCTAAAGAAATCAAAACTACAAAAGAATATATTGAATAGAGCATTTGATCTC
TTCTTTATCTGCGTCGTTAAATTTTCACCTGTGGCGCTTGTAGCAGGACCATACAGATTTTCAGGAGAAACAAACTGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan