ESTScan Details for Unigene SGN-U229565

Score 
55
Direction 
Reverse
Predicted Peptide Sequence 
MAKTQSIQNLDLSNTXLPNVVRLLIWAIELHSYAKGGTFMPHEVYLTPHKHSLIEYLLARTISEDELILIRCLTMKTLGFTFKSIILSFL
PCPSALPSEIKIGDXPVILLIVFNXLGLVSDYDPSYSPVSNVFLANSSVDPDLSPGNSTFCPTGDIYCVFIYRQRVPSCHIADKENFHQL
HSK
Predicted Coding Sequence 
ATGGCAAAAACTCAAAGCATTCAGAACTTGGATTTATCTAACACTAXATTGCCAAATGTTGTTCGATTGCTAATCTGGGCTATTGAGCTT
CATTCATATGCCAAAGGTGGAACATTCATGCCACATGAGGTCTATTTGACTCCTCACAAACATTCTCTCATAGAATATCTTCTGGCTAGA
ACAATCTCTGAAGATGAGTTAATCCTGATTAGATGCCTGACCATGAAAACACTTGGCTTTACATTCAAGTCGATCATTTTGTCCTTCTTG
CCATGCCCATCTGCACTCCCATCTGAAATCAAAATAGGAGACAXCCCTGTGATTTTGTTGATTGTCTTTAATXCATTGGGTTTGGTGAGT
GACTATGATCCTTCTTATTCXCCGGTATCTAATGTCTTCCTGGCTAATTCCTCTGTAGACCCCGACTTGTCTCCTGGAAACTCAACTTTC
TGCCCAACAGGAGATATCTACTGTGTGTTCATTTACCGCCAACGTGTACCATCATGTCACATTGCAGACAAAGAGAACTTCCATCAACTT
CACAGTAAA\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTCAAGATACAATTTCTACTAAAATCATCATAAACTTCAGTTACATCAGCTACTTTCAGCAGGCAATTTCTTAAA
TGTTTGTCTTAATGAAAAAAACTAAATCCTAAAGGAAAAAA
(5')ATGGCAAAAACTCAAAGCATTCAGAACTTGcGATTTATCTAACAC
TAXATTGCCAAATGTTGTTCGATTGCTAATCTGGGCTATTGAGCTTCATTCATATGCgCAAAGGTGGAACATTCATGCCACATGAGGTCT
ATTTGACTCCTCACAAACATTCTCTCATAGAATATCTTCTGGCTAGAACAATCTCTGAAGATGAGTTAATCCTGATTAGATGCCTGACCA
TGAAAACgACTTGGCTTTACATTCAAGTCGATCATTTTGTCCTTCTTGCCATGCCCATCTGCACTCCCATCTGAAATCAAAATAGGAGAC
AXCCCTGTGATTTTGTTGATTGTCTTTAATXCATTGGGTTTGGTGAGTGACTATGATCCTTCTTATTCXCCGGTATCTAATGTCTTCCTG
GCTAATTCCTCTGTAGACCCCGACTTGTCTCCTGGAAACTCAACTTTCTGCCtCAACAGGAGATATCTACTGTGTGTTCATTTACCGCCA
ACGTGTACCATCATGTCACATTGCAGACAAAGAGAACTTCCATCAACTTCACAGTAAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan