ESTScan Details for Unigene SGN-U229581

Score 
329
Direction 
Reverse
Predicted Peptide Sequence 
IQKGVMSIVWSGAAENTSGRSAVDSQIGDGLHIVEWVKKKMGSFEPAVTVLDTKLQGLPDQVVQEMLQTLGIAMFCVNSSPVERPTMKEV
VALLMEVKSSPDQEFGKTSQPLIKQSSTQS
Predicted Coding Sequence 
XXTATACAGAAAGGAGTGATGTCTATAGTATGGAGTGGTGCTGCTGAAAATACTAGTGGACGTAGCGCTGTTGATTCTCAGATAGGTGAT
GGGCTTCACATCGTCGAGTGGGTAAAGAAGAAAATGGGAAGCTTTGAACCAGCTGTTACAGTTCTCGACACTAAGCTACAAGGTTTACCG
GATCAAGTGGTCCAAGAAATGCTGCAAACGCTTGGAATAGCGATGTTCTGTGTCAACTCATCGCCAGTTGAAAGGCCAACGATGAAGGAA
GTTGTGGCACTTCTTATGGAAGTAAAGAGTTCACCTGATCAAGAATTTGGGAAAACTTCTCAGCCTCTAATAAAACAGTCCTCAACTCAA
AGTTGA\
Edits in Original Sequence 
(5')XXTATACAGAAAGGAGTGATGTCTATAGTATGGAGTGGTGCTGCTGAAAATACtTAGTGGACGTAGCGCTGTTGATTCTCAGATAG
GTGATGGGCTTCACATCGTCGAGTGGGTAAAGAAGAAAATGGGAAGCTTTGAACCAGCTGTTACAGTTCTCGACACTAAGCTACAAGGTT
TACCGGATCAAGTGGTCCAAGAAATGCTGCAAACGCTTGGAATAGCGATGTTCTGTGTCAACTCATCGCCAGTTGAAAGGCCAACGATGA
AGGAAGTTGTGGCACTTCTTATGGAAGTAAAGAGTTCACCTGATCAAGAATTTGGGAAAACTTCTCAGCCTCTAATAAAACAGTCCTCAA
CTCAAAGTTGA\(3')TTAATTTTGTAATGTTTTTTGCTTTTGACTAAGATGAGTAGGAATTAATTTTCTTTAGTTCCCAAGATATGATC
AAGCCAACTCATAGTTCCAAGCATTGGATAATGTCTTGAGGTCCATTGTGTACATATTTCAGAAACATTTATGTAGTTTTTCTGCTTAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan