Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U229999

Score 
329
Direction 
Reverse
Predicted Peptide Sequence 
AVDFVESQERLKGSPPTAKSVLENLPLVVVSDEHLKGSNAACAVCKDEILSTKKMTGCPVLTTTIVIXIMPWLNIRNTCPVCRHELPTDN
ADYERENGRSAGQGHVNDFQVRYNFESGSDIANSVLLTGFVDXSTNLILAEHVENLFIFFFLNFFSVGTVYVKLPILFCEYHIDS
Predicted Coding Sequence 
XXTGCTGTTGATTTTGTTGAAAGCCAAGAGAGGTTAAAGGGTAGTCCACCAACAGCTAAATCTGTGCTGGAAAATCTTCCTTTGGTGGTC
GTGAGTGATGAACATTTGAAAGGAAGCAATGCAGCTTGTGCAGTTTGCAAAGATGAGATTTTGTCAACGAAGAAAATGACTGGTTGCCCT
GTTCTCACTACTACCATTGTGATTGXTATTATGCCATGGCTAAATATCCGTAATACATGTCCTGTTTGTCGCCACGAGTTGCCCACGGAT
AATGCTGATTATGAGAGGGAAAATGGAAGGAGTGCTGGTCAAGGACATGTTAATGATTTTCAGGTTAGATACAATTTTGAATCTGGCTCT
GACATTGCAAATTCTGTTCTGTTGACAGGTTTCGTGGACATXAGTACTAATCTCATTTTAGCTGAGCATGTTGAAAATCTATTCATATTT
TTCTTCCTTAACTTTTTTAGTGTTGGTACTGTATATGTAAAGTTGCCAATTTTATTCTGTGAGTATCACATAGACAGCTAG\
Edits in Original Sequence 
(5')XXTGCTGTTGATTTTGTTGAAAGCCAAGAGAGGTTAAAGGGTAGTCCACCAACAGCTAAATCTGTGCTGGAAAATCTTCCTTTGGT
GGTCGTGAGTGATGAACATTTGAAAGGAAGCAATGCAGCTTGTGCAGTTTGCAAAGATGAGATTTTGTCAACGAAGAAAATGACTaGGTT
GCCCTGTTCTCACTACTACCATTGTGATTGXTATTATGCCATGGCTAAATATCCGTAATACATGTCCTGTTTGTCGCCACGAGTTGCCCA
CGGATAATGCTGATTATGAGAGGGAAAATGGAAGGAGTGCTGGTCAAGGACATGTTAATGATTTTCAGGTTAGATACAATTTTGAATCTG
tGCTCTGACATTGCAAATTCTGTTCTGTTGACAGGTTTCGTGGACATXAGTACTAATCTCATTTTAGCTGAGCATGTTGAAAATCTATTC
ATATTTTTCTTCCTTAACTTTTTTAGTGTTGGTACTGTATATGTAAAGTTGCCAATTTTATTCTGTGAGTATCACATAGACAGCTAG\(3')
TTGGATTACCACCGAAAAATGATGAAAACTCTAATTCTCTGTATATTCAAAGGTTAGTACCGTTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan