ESTScan Details for Unigene SGN-U230034

Score 
543
Direction 
Forward
Predicted Peptide Sequence 
NIAFVFLKDLQGNISSWTPFAPMFNKHGGVRKPSAPRVYIDDYEDVFLGLSESSEESDEDWKGDNKMKKAKSGKRKSKRFRRKKGKMQKS
DKGKNVVGNAGDDVQDVSVTQGGVEVPNVTTAQSSKRAGNARRQAGRVTKDVGKLDLNVEFSNEVEEPPAPGVGQGNGAGTGEDGNIEGI
EFFEGLDEFLSSLPILNAVGDDKVKAALAK
Predicted Coding Sequence 
XXAAATATTGCCTTTGTATTTCTTAAAGATCTCCAAGGCAATATTTCGAGCTGGACTCCGTTTGCACCCATGTTTAATAAACATGGAGGT
GTAAGAAAGCCATCTGCTCCCAGAGTTTATATTGATGATTATGAGGATGTGTTTCTGGGATTATCAGAGTCGAGTGAGGAGTCAGATGAG
GATTGGAAGGGTGATAATAAGATGAAGAAGGCAAAGAGTGGGAAACGAAAAAGTAAAAGGTTTAGGAGAAAGAAGGGCAAGATGCAGAAA
TCTGACAAGGGAAAGAATGTTGTAGGGAATGCTGGTGATGATGTGCAAGATGTTTCAGTGACTCAAGGGGGTGTAGAAGTGCCCAATGTT
ACAACAGCTCAATCAAGCAAGAGAGCTGGTAATGCCAGAAGGCAAGCTGGAAGGGTTACCAAAGATGTTGGGAAATTGGATTTGAATGTG
GAATTCAGTAATGAGGTTGAAGAGCCCCCTGCACCTGGGGTAGGCCAAGGCAATGGAGCTGGAACAGGGGAGGATGGGAACATTGAAGGG
ATTGAGTTTTTTGAAGGTCTTGATGAATTCCTAAGCAGTCTTCCTATACTCAATGCTGTGGGTGATGATAAGGTTAAGGCTGCXCTAGCA
AAGTAA\
Edits in Original Sequence 
(5')XXAAATATTGCCTTTGTATTTCTTAAAGATCTCCAAGGCAATATTTCGAGCTGGACTCCGTTTGCACCCATGTTTAATAAACATGG
AGGTGTAAGAAAGCCATCTGCTCCCAGAGTTTATATTGATGATTATGAGGATGTGTTTCTGGGATTATCAGAGTCGAGTGAGGAGTCAGA
TGAGGATTGGAAGGGTGATAATAAGATGAAGAAGGCAAAGAGTGGGAAACGAAAAAGTAAAAGGTTTAGGAGAAAGAAGGGCAAGATGCA
GAAATCTGACAAGGGAAAGAATGTTGTAGGGAATGCTGGTGATGATGTGCAAGATGTTTCAGTGACTCAAGGGGGTGTAGAAGTGCCCAA
TGTTACAACAGCTCAATCAAGCAAGAGAGCTGGTAATGCCAGAAGGCAAGCTGGAAGGGTTACCAAAGATGTTGGGAAATTGGATTTGAA
TGTGGAATTCAGTAATGAGGTTGAAGAGCCCCCTGCACCTGGGGTAGGCCAAGGCAATGGAGCTGGAACAGGGGAGGATGGGAACATTGA
AGGGATTGAGTTTTTTGAAGGTCTTGATGAATTCCTAAGCAGTCTTCCTATACTCAATGCTGTGGGTGATGATAAGGTTAAGGCTGCXCT
AGCAAAGTAA\(3')GGCATTTCTTTTGTTCTAGTTGTAGCTTCCTTTTGTCTTTTGTATGTTTTAGTAAGGGATGAAAAGCTACTCAGG
CATTGGCCTTGATGTTTTCATTGTAATGCTAATGTATTGCTAGTTTGCATTGAAGTAATTGCAATAATCAGCTTTTAGCTCTAAAAAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan