ESTScan Details for Unigene SGN-U230233

Score 
124
Direction 
Reverse
Predicted Peptide Sequence 
MAXLEFKAKPLVMAYQPTKSHNQKNRKNDKANSYRINEIVTKKKKSTLEIEIVXKMSVVVVDGPMMEEFVDDAEAFGKWTDKHFDMLDTD
GNGECLEGGP
Predicted Coding Sequence 
ATGGCTCAXCTAGAATTTAAGGCAAAACCTTTAGTTATGGCCTATCAACCAACAAAAAGCCACAACCAAAAGAATAGGAAGAATGACAAA
GCAAATTCTTATAGAATAAATGAAATAGTAACAAAGAAGAAGAAATCAACACTTGAAATTGAAATCGTCGAXAAAATGAGTGTAGTTGTT
GTTGATGGTCCAATGATGGAAGAATTCGTTGATGACGCTGAGGCGTTTGGCAAGTGGACGGACAAACATTTTGATATGCTAGACACAGAT
GGAAACGGGGAATGTCTCGAGGGGGGGCCC\
Edits in Original Sequence 
AATGAACCGGCATCTCACCGGGGGAATGGATATTTGTTGTTAATGCGTGGTGTATGATTATAGGGGTCTGGTCACGTTATTCTCTCTATC
ATCTCTTGTATGCACATTTTAGACTTATTAGGTTATAGTTAGCTTTGTTTACTTGGGTACGGTACTCCCTTCAGATTGTGGCATATGAAT
TGCTTTACTCTCTCTACTTGTGCTCAATTGAAGATTCTCGTAAAGACTTGAATGTGTTGAGGTTGAACCTTATTCAAATCATCTTTAATT
TCGACTTTTACAATTTTGCCATAGCTGGTAGTTTTAGTAGTTTAGTATTAAATATATTTTTCAAGAGTTGACTTTTGGATCAAAGCATGG
TTGAAAAATAACCCACTTATTTTATGTTAAATCTTAGTGGGAGACCCGTATAGAGTGGAAACTATTCTACTTTAATTCTTAAATCCATTA
TAATAATAATAATGAAAGATTGATAGGGCAAGAAAGTCCCAC
(5')ATGGCTCAXCTAGAATTTAAGGCAAAACCTTTAGTTATGGCCTA
TCAACCAACAAAAAGCCACAACCAAAAGAATAGGAAGAATGACAAAGtCAAATTCTTATAGAATAAATGAAATAGTAACAAAGAgAGAAG
AAATCAACACTTGAAATTGAAATCGTCGAXAAAATGAGTGTAGTTGTTGTTGATGGTCCAATGATGGAAGAATTCGTTGATGACGCTGAG
GCGTTTGGCAAGTGGACGGACAAACATTTTGATATGCTAGACACAGATGGAAACGGGGAATGTCTCGAGGGGGGGCCC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan