ESTScan Details for Unigene SGN-U230376

Score 
220
Direction 
Reverse
Predicted Peptide Sequence 
KALAQSGVSKEDVNYINAHGTSTPAGDLKEYHAIVHCFGQNPELRINSTKSMIGHLLGAAGAVEAVATIQAIRTGWVHPNINLDTPDEGV
DTNVLVGSKKERLDIKVAISNSFGFGGHNSSILFAPYKKYIVHPNKPKEIELGSLISSYMESKLTMTSLVEEGFVVAGDNCWSKHVKGKI
A
Predicted Coding Sequence 
XXAAAGGCATTAGCTCAGTCTGGTGTATCCAAGGAAGATGTGAACTACATTAATGCGCATGGCACTTCCACACCAGCAGGGGATCTCAAA
GAGTACCACGCGATTGTACATTGTTTTGGCCAGAACCCAGAGTTACGAATTAACTCCACGAAGTCTATGATTGGTCACCTGCTAGGAGCT
GCTGGTGCTGTTGAAGCTGTAGCAACTATTCAGGCAATACGAACTGGATGGGTTCATCCGAATATAAATCTTGATACCCCAGATGAGGGT
GTGGATACAAATGTACTTGTGGGTTCGAAAAAAGAAAGATTGGATATTAAGGTGGCAATATCGAATTCATTTGGATTTGGTGGCCATAAT
TCATCGATATTATTTGCTCCCTACAAGAAATATATTGTCCATCCCAACAAACCTAAGGAAATTGAATTAGGGTCCTTGATTTCGAGTTAC
ATGGAGTCAAAATTGACGATGACTTCTCTAGTGGAAGAAGGATTTGTAGTAGCCGGAGATAATTGTTGGAGCAAGCACGTGAAAGGGAAA
ATCGCGTAG\
Edits in Original Sequence 
(5')XXAAAGGCATTAGCTCAGTCTGGTGTATCCAAGGAAGATGTGAACTACATTAATGCGCATGGCACTTCCACACCAGCAGGGGATCT
CAAAGAGTACCACGCGATTGTACATTGTTTTGGCCAGAACCCAGAGTTACGAATTAACTCCACGAAGTCTATGATTGGTCACCTGCTAGG
AGCTGCTGGTGCTGTTGAAGCTGTAGCAACTATTCAGGCAATACGAACTGGATGGGTTCATCCGAATATAAATCTTGATACCCCAGATGA
GGGTGTGGATACAAATGTACTTGTGGGTTCGAAAAAAGAAAGATTGGATATTAAGGTGGCAATATCGAATTCATTTGGATTTGGTGGCCA
TAATTCATCGATATTATTTGCTCCCTACAAGtAAATATATTGTCCATCCCAACAAACCTAAGGtAAATTGAATTAGGGTCCTTGATTTCG
AGTTACATGGAGTCAAAATTGACGATGACTTCTCTAGTGGAAGAAGGtATTTGTAGTAGCCGGtAGATAATTGTTGGAGCAAGCACGTGA
AAGGGAAAATCGCGTAG\(3')AATTTTCCTTTTCGATCATGGCTACTATAGCATTCTTGGTTTCGATCATAAGATATATATAGGTTGAT
CCGATATCTGATTCAAATCCAATATAGTTTTCAAAAATTATTGTATCAAAATTGTTGTTACTATAGAACATTTCTAATAATAGCATACTA
TTATTCTCTTCAAAAAAAAAAAAAAAAAACTCGAGATAGTTCCTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan