ESTScan Details for Unigene SGN-U230568

Score 
341
Direction 
Forward
Predicted Peptide Sequence 
GWVIEEVPRTDGSSMVDKYYYEPGSGQKFRSRIAAQRYLAQMRENVPLSATLEELKENKPLSKMFKLYHHAKKSLPCKRNIVTENSSFLS
PPAKVNWVLSSPKGDAWNPLISGTPIPDSLKQQWTKRFKLFMNDENLNAEKSARKALNGENAVEARTASAYENWMLNLVHTNIMQLLNHF
AV
Predicted Coding Sequence 
XXTGGTTGGGTGATAGAAGAGGTACCACGTACAGACGGAAGCAGCATGGTGGATAAGTATTACTATGAACCAGGTAGTGGACAAAAATTT
AGATCCAGGATAGCGGCACAAAGATACTTGGCTCAAATGAGAGAAAATGTTCCTTTGTCCGCTACTCTAGAAGAATTGAAAGAGAATAAA
CCACTGTCCAAGATGTTTAAGTTGTACCATCATGCAAAGAAATCTCTTCCATGTAAGAGGAACATCGTTACAGAGAATTCATCGTTTCTT
TCTCCACCAGCAAAAGTAAATTGGGTTCTTTCTAGTCCTAAAGGGGATGCTTGGAATCCTTTGATTTCTGGAACACCTATTCCTGATTCA
CTAAAACAACAATGGACTAAAAGATTCAAGTTGTTCATGAATGACGAGAACCTGAATGCAGAAAAGTCAGCTAGAAAGGCACTAAACGGA
GAGAATGCAGTTGAAGCTCGGACTGCTTCTGCCTATGAGAATTGGATGCTGAATCTTGTACATACTAACATTATGCAACTCCTTAATCAC
TTTGCTGTTTAA\
Edits in Original Sequence 
(5')XXTGGTTGGGTGATAGAAGAGGTACCACGTACAGACGGAAGCAGCATGGTGGATAAGTATTACTATGAACCAGGTAGTGGACAAAA
ATTTAGATCCAGGATAGCGGCACAAAGATACTTGGCTCAAATGAGAGAAAATGTTCCTTTGTCCGCTACTCTAGAAGAATTGAAAGAGAA
TAAACCACTGTCCAAGATGTTTAAGTTGTACCATCATGCAAAGAAATCTCTTCCATGTAAGAGGAACATCGTTACAGAGAATTCATCGTT
TCTTTCTCCACCAGCAAAAGTAAATTGGGTTCTTTCTAGTCCTAAAGGGGATGCTTGGAATCCTTTGATTTCTGGAACACCTATTCCTGA
TTCACTAAAACAACAATGGACTAAAAGATTCAAGTTGTTCATGAATGACGAGAACCTGAATGCAGAAAAGTCAGaCTAGAAAGGCACTAA
ACGGAGAGAATGCAGTTGaAAGCTCGGACTGCTTCTGaCCTATGAGAATTGGATGCTGAATCTTGTACATACTAACATTATGCAACTCCT
TAATCACTTTGCTGTTTAA\(3')CCACTGTAGAGAATCTGTTGTCCTGTTTATTCTGTGTTTGTTCATGTGTTGTATAACAATTCGACA
ACTTTTTTTCTTATGGACATGTTCAAGTACGGATGTACAATTAAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan