Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U230596

Score 
494
Direction 
Reverse
Predicted Peptide Sequence 
AKSALRVVVGSILVXTEKLLNVHPFDGSKVLIVKVDQSTGFQGLIVNKHISWDSLDELEDGVQLLKEAPLSFGGPVMKRGMPFVAFSRKY
IVNQSMEVLPNVFFLDQRATVVIIEELRLGNQSIHDLWFFLGFSSWGWGQLFDEIAEGAWMVRNHDEEQIDWAWR
Predicted Coding Sequence 
GCAAAATCAGCTCTTCGTGTTGTTGTTGGTTCCATCCTTGTGNCTACAGAGAAGCTTCTAAATGTTCACCCGTTTGATGGATCCAAAGTA
CTTATTGTGAAAGTGGATCAAAGCACCGGATTTCAAGGTCTGATTGTCAACAAACATATCAGTTGGGACTCTCTTGATGAACTTGAAGAT
GGAGTACAGCTTCTGAAGGAGGCTCCTCTTTCTTTTGGTGGCCCTGTCATGAAACGTGGAATGCCTTTTGTTGCGTTTTCCAGAAAGTAT
ATAGTTAACCAGTCAATGGAGGTGCTGCCAAATGTATTTTTTCTTGACCAAAGGGCCACAGTAGTTATCATAGAAGAGCTAAGGTTAGGA
AACCAGTCTATCCATGACTTGTGGTTCTTTTTGGGATTTTCAAGTTGGGGTTGGGGCCAGCTATTTGATGAAATTGCTGAAGGAGCTTGG
ATGGTAAGAAATCATGATGAGGAACAAATAGATTGGGCTTGGAGATGA\
Edits in Original Sequence 
(5')GCAAAATCAGCTCTTCGTGTTGTTGTTGGTTCCATCCTTGTGNCTACAGAGAAGCTTCTAAATGTTCACCCGTTTGATGGATCCAA
AGTACTTATTGTGAAAGTGGATCAAAGCACCGGATTTCAAGGTCTGATTGTCAACAAACATATCAGTTGGGACTCTCTTGATGAACTTGA
AGATGGAGTACAGCTTCTGAAGGAGGCTCCTCTTTCTTTTGGTGGCCCTGTCATGAAACGTGGAATGCCTTTTGTTGCGTTTTCCAGAAA
GTATATAGTTAACCAGTCAATGGAGGTGCTGCCAAATGTATTTTTTCTTGACCAAAGGGCCACAGTAGTTATCATAGAAGAGCTAAGGTT
AGGAAACCAGTCTATCCATGACTTGTGGTTCTTTTTGGGATTTTCAAGTTGGGGTTGGGGCCAGCTATTTGATGAAATTGCTGAAGGAGC
TTGGATGGTAAGAAATCATGATGAGGAACAAATAGATTGGGCTTGGAGATGA\(3')CCTAGATCTTCTGCGTTATATTAAATTGCTGAA
TTTATTATTGGTATTTATTTCTTTCAAGAGCCAGCAAGAGTATTAGAATTTGATTTTTAATTGACAGTGTGTAACATTTTTGTTGGATAA
ATAACATTCAAATATCCTAGCGCAGCCTATTTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan