ESTScan Details for Unigene SGN-U230656

Score 
558
Direction 
Reverse
Predicted Peptide Sequence 
PEKNFLSRMKKKGKDGSFLIAAAGLCLCDVAEPASTSRRALRGAKIPESEYTTLPNGLKYYDLKVGAGAEAVKGSRVAVRSTXVAKWRNI
TFMTSRQGMGVGGGTPYGFDVGQSERGTVLKGLDLGVQGMRVGGQRLLIVPPELAYGKKGVQEIPPNATIEMDIELLSIKQSPFGTPVKI
VEG
Predicted Coding Sequence 
XXTCCAGAAAAGAATTTTCTCAGCAGAATGAAGAAGAAAGGCAAAGATGGCTCTTTTCTAATAGCTGCTGCTGGCCTTTGCCTCTGCGAT
GTGGCTGAGCCCGCTAGCACAAGCAGAAGAGCTCTCAGGGGAGCAAAAATACCAGAGAGCGAGTACACAACTCTTCCAAATGGTCTAAAG
TATTATGACTTGAAGGTCGGCGCTGGAGCTGAAGCTGTGAAGGGATCTAGAGTTGCAGTACGATCCACTXATGTTGCTAAATGGAGGAAC
ATCACATTCATGACAAGTAGACAAGGAATGGGAGTTGGTGGTGGAACACCATATGGATTTGACGTTGGTCAATCAGAAAGGGGAACAGTC
CTTAAAGGATTAGATCTCGGTGTTCAAGGGATGCGAGTAGGAGGGCAGCGCCTGCTCATCGTACCTCCTGAGCTAGCTTATGGTAAAAAA
GGCGTGCAGGAAATTCCTCCAAATGCAACAATTGAGATGGATATTGAACTGCTATCTATTAAACAAAGCCCATTCGGAACTCCTGTCAAA
ATTGTTGAAGGATAA\
Edits in Original Sequence 
(5')XXTCCAGAAAAGAATTTTCTCAGCAGAATGAAGAAGAAAGGCAAAtGATGGCTCTTTTCTAATAGCTGCTGCTGGCCTTTGCCTCT
GCGATGTGGCTGAGCCCGCTAGCACAAGCAGAAGAGCTCTCAGGGGAGCAAAAATACCAGAGAGCGAGTACACAACTCTTCCAAATGGTC
TAAAGTATTATGACTTGAAGGTCGGCGCTGGAGCTGAAGCTGTGAAGGGATCTAGAGTTGCAGTACGATCCACTXATGTTGCTAAATGGA
GGAACATCACATTCATGACAAGTAGACAAGGAATGGGAGTTGGTGGTGGAACACCATATGGATTTGACGTTGGTCAATCAGAAAGGGGAA
CAGTCCTTAAAGGATTAGATCTCGGTGTTCAAGGGATGCGAGTAGGAGGGCAGCGCCTGCTCATCGTACCTCCTGAGCTAGCTTATGGTA
AAAAAGGCGTGCAGGAAATTCCTCCAAATGCAACAATTGAGATGGATATTGAACTGCTATCTATTAAACAAAGCCCATTCGGAACTCCTG
TCAAAATTGTTGAAGGATAA\(3')CCACAGTGTTCACCTACTTCATGTTATATTGATTCATCACCTGCAAAAGTACTCAGCCTATTGTA
TGAATTTTGAGAATACTAAGAGATCTGCTTCTGATTTGGTATTTACCAAGAAAATGTCCCTAAATATGTTAGTATTGTATAGTTCAAACT
CATTTTCATGTTATGAGATTCAAATTGCTTTGAGCATGTAATAGTGCTGTATGGAGTTGTTCGAGAATAACCCCAAAGAAATGCCAGTGA
GAAAATTCAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan