ESTScan Details for Unigene SGN-U230664

Score 
335
Direction 
Reverse
Predicted Peptide Sequence 
MGVVIIDGSTIRDFVNDEAAFTKSIDKGFTDLDLNNDGVLSRSELRKAFESLHLIESHFGVDVAATPEELTDLYDSIFEKFIATTTALST
ERNLGRDEENYAGDADGLGSSPIQMALDDSEQSLIKQAADLEASKLPA
Predicted Coding Sequence 
ATGGGAGTGGTGATTATCGACGGATCAACAATTCGAGATTTCGTCAACGACGAAGCGGCTTTCACAAAGTCAATTGATAAGGGATTTACC
GATTTGGACCTCAATAACGACGGCGTTTTGTCACGATCCGAGCTCCGCAAAGCCTTCGAATCTCTCCATCTCATTGAATCTCACTTCGGC
GTCGACGTCGCCGCCACGCCGGAGGAACTCACCGACCTCTACGATTCCATTTTCGAGAAGTTCATTGCGACCACAACGGCACTGTCGACC
GAGAGGAATTTGGGAAGAGATGAGGAAAATTATGCTGGCGATGCTGATGGACTTGGTTCATCGCCGATTCAAATGGCGCTTGATGATAGT
GAACAGAGTTTGATTAAGCAAGCTGCTGATCTCGAAGCTTCTAAGCTTCCTGCCTAA\
Edits in Original Sequence 
CCATAAATCCTGTCCCAATTTCCCNTATCACTGNCATCAGTNCCACATAATCATAAGAAACAATTTCTCAAACAGTCAAAAAAATTAAAC
AAAA
(5')ATGGGAGTGGTGATTATCGACGGATCAACAATTCGAGATTTCGTCAACGACGAAGCGGCTTTCACAAAGTCAATTGATAAGG
GATTTACCGATTTGGACCTCAATAACGACGGCGTTTTGTCACGATCCGAGCTCCGCAAAGCCTTCGAATCTCTCCATCTCATTGAATCTC
ACTTCGGCGTCGACGTCGCCGCCACGCCGGAGGAACTCACCGACCTCTACGATTCCATTTTCGAGAAGTTCgATTGCGACCACAACGGCA
CTGTCGACCGAGAGGAATTTGGGAAcGAGATGAGGAAAATTATGCTGGCGATcGCTGATGGACTTGGTTCATCGCCGATTCAAATGGCGC
TTGATGATAGTGAACAGAGTTTGATTAAGCAAGCTGCTGATCTCGAAGCTTCTAAGCTTCCTGCCTAA\(3')CCGCTTTCGATTTGTTT
TGCAATAAGTCCCTCTTTTTGTTGTTTAATTTCAACTTTGACATCTCCTTGTGGTGTGCTCCTAATTTAATGGTTTTTATATAATATTGC
GTTTGAGGTAAGAATTCAACCAACTGATCTAATTCAACCAGATCAATTGTTCAATGTATTTCACATTATATGTTGGTCAATAATCGTTGG
GTCAAGTTAATTTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan