ESTScan Details for Unigene SGN-U230667

Score 
494
Direction 
Forward
Predicted Peptide Sequence 
DRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLFNAYKVIIGSADLKANHAIRQHVEIVSESQKYNXVGVIPLFYYFEY
WRPQNLLTMSFHSWLDSSIELHLFCKFRLVKLLEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKS
PIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQKVSPELAKMGRGAPPPP
G
Predicted Coding Sequence 
XXTGACCGCATGCTAGACATGGGTTTTGAACCTCAGATCCGCAAAATTGTATCTCAGATACGCCCAGATCGTCAAACGCTGTATTGGAGT
GCCACATGGCCCAAAGAAGTTGAGCAGCTTGCAAGACAATTCCTTTTCAATGCATACAAAGTAATTATTGGTTCAGCTGACCTGAAAGCT
AATCACGCTATTCGTCAGCATGTGGAAATCGTCTCGGAGAGCCAGAAGTATAATAXAGTAGGTGTTATCCCTTTATTCTATTATTTCGAG
TATTGGAGGCCTCAAAACCTTTTAACAATGTCTTTTCACAGTTGGTTAGATTCTTCCATTGAACTACACCTGTTTTGTAAATTCAGATTA
GTAAAGTTGCTGGAAGATATTATGGATGGTAGTCGGATTTTAATATTCATGGACACTAAAAAGGGGTGTGACCAAGTAACTCGGCAGCTC
CGGATGGATGGTTGGCCGGCACTTTCTATTCATGGTGATAAGAGTCAAGCAGAAAGAGATTGGGTCCTTTCAGAATTCAAAGCTGGAAAG
TCTCCTATAATGACAGCTACAGACGTTGCTGCTCGAGGTCTAGATGTGAAGGATGTAAAGTTTGTAATCAACTATGATTTTCCTGGATCA
TTGGAGGACTATGTTCACCGAATTGGTAGAACGGGAAGAGCTGGTGCCTCAGGGACAGCATACACATTCTTTACTGCAGCGAATGCTAGG
TTTGCGAAGGACCTTGTTAACATTCTTGAGGAGGCTGGACAGAAAGTCAGTCCTGAATTGGCAAAAATGGGACGTGGTGCTCCTCCCCCT
CCTGGT\
Edits in Original Sequence 
(5')XXTGACCGCATGCTAGACATGGGTTTTGAACCTCAGATCCGCAAAATTGTATCTCAGATACGCCCAGATCGTCAAACGCTGTATTG
GAGTGCCACATGGCCCAAAGAAGTTGAGCAGCTTGCAAGACAATTCCTTTTCAATGCATACAAAGTAATTATTGGTTCAGCTGACCTGAA
AGCTAATCACGCTATTCGTCAGCATGTGGAAATCGTCTCGGAGAGCCAGAAGTATAATAXAGTAGGgTGTTATCCCTTTATTCTATTATT
TCGAGTATTGGAGGCCTCAAAACCTTTTAACAATGTCTTTTCACAGTTGGTTAGATTCTTCCATTGAACTACACCTGTTTTGTAAATTCA
GATTAGTAAAGTTGCTGGAAGATATTATGGATGGTAGTCGGATTTTAATATTCATGGACACTAAAAAGGGGTGTGACCAAGTAACTCGGC
AGCTCCGGATGGATGGTTGGCCGGCACTTTCTATTCATGGTGATAAGAGTCAAGCAGAAAGAGATTGGGTCCTTTCAGAATTCAAAGCTG
GAAAGTCTCCTATAATGACAGCTACAGACGTTGCTGCTCGAGGTCTAGATGTGAAGGATGTAAAGTTTGTAATCAACTATGATTTTCCTG
GATCATTGGAGGACTATGTTCACCGAATTGGTAGAACGGGAAGAGCTGGTGCCTCAGGGACAGCATACACATTCTTTACTGCAGCGAATG
CTAGGTTTGCGAAGGACCTTGTTAACATTCTTGAGGAGGCTGGACAGAAAGTCAGTCCTGAATTGGCAAAAATGGGACGTGGTGCTCCTC
CCCCTCCTGGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan